SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0236343 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0236343
Domain Number 1 Region: 23-254,321-370
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.66e-95
Family Type II chitinase 0.00000274
Further Details:      
 
Domain Number 2 Region: 254-320
Classification Level Classification E-value
Superfamily Chitinase insertion domain 3.27e-20
Family Chitinase insertion domain 0.00048
Further Details:      
 
Domain Number 3 Region: 412-463
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000146
Family Tachycitin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236343   Gene: FBgn0209041   Transcript: FBtr0237851
Sequence length 464
Comment type=protein; loc=scaffold_12875:join(12455786..12455849,12455920..12456096,12456163..12456433,12456491..12456699,12456762..12457435); ID=FBpp0236343; name=Dvir\GJ21926-PA; parent=FBgn0209041,FBtr0237851; dbxref=FlyBase:FBpp0236343,FlyBase_Annotation_IDs:GJ21926-PA,GB_protein:EDW61252,REFSEQ:XP_002050059,FlyMine:FBpp0236343; MD5=376885457e2d42be6d44fc232540c966; length=464; release=r1.2; species=Dvir;
Sequence
MKLFACLVFSLICLGQLASSDKIINCYWGTWANYRPGDGKFEPSNIDPSLCTHISYTFFG
ISDSGEFKSLDTWLDMDDGLGFISKTIALKQVNPKLKILAVVGGWNEGSTKYSAMAADPA
KRATFISTTLSFIQQYGFDGLDLDWEYPGQRGGNDADRANFVTLLREIKESFDPHGLELG
IAVGASEASATISYDIPAISQHLTFINVMTYDFHMALDGYLGFNAPLPEVEKSIDYWLQQ
GAPAEKLILGIGFYGHSYQMVDSSQNQPGAACIGPGNEGVYTREKGFLGYHEICQNNWQT
VFDGESKAPYAFQGDQWIGYDNVESIELKMQLVASRNLGGAMTWSIETDDFRGLCGEAYP
LLKTMNRALGVDVGNGGGGGGGGSVTPAPTPSPAPTPSPTPGGGGGGGSNESCSTDGYFL
HSSDCSRYYQCVDGIRYDFQCGGGLYFDVSSLNCNWASEVYCPY
Download sequence
Identical sequences B4LPJ3
7244.FBpp0236343 XP_002050059.1.90633 FBpp0236343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]