SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0236439 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0236439
Domain Number - Region: 156-184
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236439   Gene: FBgn0209136   Transcript: FBtr0237947
Sequence length 235
Comment type=protein; loc=scaffold_12875:join(13709058..13709158,13709218..13709815,13709881..13709889); ID=FBpp0236439; name=Dvir\GJ22022-PA; parent=FBgn0209136,FBtr0237947; dbxref=FlyBase:FBpp0236439,FlyBase_Annotation_IDs:GJ22022-PA,GB_protein:EDW61411,REFSEQ:XP_002050218,FlyMine:FBpp0236439; MD5=a524bf6dba7f59665d46139d3aec7797; length=235; release=r1.2; species=Dvir;
Sequence
MWTYMMAAARGDRVNTMMSSRRRPETESPKYGYNLSRPMYRTTRFVGPAASAPAQLPYGS
GGGSSSTSSSCNAAQPLPMAHEELEISGGLYAPFQPTLAAVSMEGVCLPRKHLIANQTAI
PMGPDSDEPEEQQLHYPRSSCSSSNWQPRQRIALDVNQDDDDDDADDDEDDDDDDDDNDD
ADVEATAIGRGNGFADARGKDNQEEAIAPADQRSTQPRANDANYLENGRKLIQYP
Download sequence
Identical sequences FBpp0236439 7244.FBpp0236439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]