SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0236496 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0236496
Domain Number 1 Region: 94-165
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-19
Family Pointed domain 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236496   Gene: FBgn0209193   Transcript: FBtr0238004
Sequence length 172
Comment type=protein; loc=scaffold_12875:14189099..14189617; ID=FBpp0236496; name=Dvir\GJ22079-PA; parent=FBgn0209193,FBtr0238004; dbxref=FlyBase:FBpp0236496,FlyBase_Annotation_IDs:GJ22079-PA,GB_protein:EDW61491,REFSEQ:XP_002050298,FlyMine:FBpp0236496; MD5=762cccd911a1678bc5933957b9d0217f; length=172; release=r1.2; species=Dvir;
Sequence
MQVEASYPKYAGRVPPLDLSQVNAGQEQLQQLWASNAAAAMKRHHPYQMLDKCRGGVTVL
SEDINNNNSIATGNSQHNNMNNNTSLHHPIGSDGLPVDPRDWTRADVWKWLISMAVSEGL
EVTPELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMALLS
Download sequence
Identical sequences B4LJ55
XP_002050298.1.90633 FBpp0236496 7244.FBpp0236496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]