SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0236569 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0236569
Domain Number 1 Region: 66-131
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000235
Family Tachycitin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236569   Gene: FBgn0209265   Transcript: FBtr0238077
Sequence length 1348
Comment type=protein; loc=scaffold_12875:join(15097495..15097726,15097785..15098746,15099345..15101025,15101094..15102265); ID=FBpp0236569; name=Dvir\GJ22152-PA; parent=FBgn0209265,FBtr0238077; dbxref=FlyBase:FBpp0236569,FlyBase_Annotation_IDs:GJ22152-PA,GB_protein:EDW61630,REFSEQ:XP_002050437,FlyMine:FBpp0236569; MD5=b75f312680096de21bb7e77f383c6d80; length=1348; release=r1.2; species=Dvir;
Sequence
MPRLRLLAPVGPHFLVLLLAVLGGARGQGSFEDADKANEYTDQQFDLRHTIPGEPGVDYP
ILSEVPKTSFVCRGRHEGYYADVESRCQAFRICAHTARSAQGFGFLCPNGTVFSQQKFVC
DWYRNVDCDQSERYYDMNRESSVGSTQEMMERVRQMMEYPTKTISQALQEQEHTQGQTQT
QAQRDHQAHAHQTLSKDLSNVSGVLSQPGAVSNGNLVVRGEDIKSEALPAPATAATVVDG
DGEDIYVNSLGELSSDPGIEFDHTNAHIIAEYPREYHYQKQKNFAERVNAGLELLSDNSA
ASNEQMAPDYIKQIRNTKEEATQLDLVSNINNLLEEVSIDLDPSVSGYQSMSPQKVKQPF
RFLSRGFAMQTNEKDGGKGASSYVYNKPKQTPGTVRFTPNELPFEAAKDTEHKLKFNNDK
TTSSSTTTTTTTSTTTEAPIADAIEELFIAPTLPPAFAEEDTTTTATFGSTIEPAPLGYG
SELPVIESIGQAAALTASLTLSEDLQQEQAPLSAAAADKTDVDLRAEKLLLAGVKLTSHA
EETALRTNKLTLGRPATSTTTTTMKPTTTPGMSTSTETVTEISSTQERIRSYRRFVQKRV
GGSGSALRRQLPPGRSTTPRTTKATSTPRSTTPTRSYSERLAASRLRLSRLSLATKPTTA
KITTAATTSSSSSSTAATTTSSTTSTTSTTESPLSYVRAGADQGPNKKISVRDIERETGQ
QRASWDSVQSNLQRFQVQRGNRVYTPVTRATSSPTTPTSSISRASTTSLTSRPTVAASVQ
QRGRNRHATYRTQAPQQRTRGTTTPRSTTSTQRTTVAALSTLSQQISALAAGYSYAPPLI
HNNAPTTAQTVIVSGTQPQAQPQAQTQPPTQQQLQLTQITSSLNPSSAFLPFDKLTRAIV
DDSILQNFKSNHAYRGAANGYSSNTQQQQQQRVTKPTTSHSYHYPKPTATAATATAAPAL
ASLRIPQRTQQQQLPQLVLPTQPGIVIARAEGQRIAPSSANTIISSLVNQPQTKTPQSNS
YVALNDFINNKFGSSSNTAGPTTIQQQQQQHSLVPQQQPQQSHQLQLLQQQQHQRPPQQQ
QQQLEQHQQQQHKQQQHQRQPLKQQQQQLSYITQRYQQPAQQQQHIQTLQQQQQYQPQQQ
QQQRQQQQHEQQQQQHQQQQPHQQQQHHQQQQRQQSQAAHQISYHSQYQQQPYQQTQQLQ
HFQQQQQQSDRPSIQSIQQPYLTPNIFVPYQQQQQHLPLFPPLAAAAAPSLAQTTRVANG
PGQQLDHLNVPLPALANGLIPAPTLQVAQKRSDVKVGQLQLSSSSKIMDQGQEMSFYAGR
TSYEVPQSSVGRLPNDITQQRRLRQRRY
Download sequence
Identical sequences FBpp0236569 7244.FBpp0236569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]