SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0236802 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0236802
Domain Number - Region: 221-256
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0341
Family Tudor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236802   Gene: FBgn0209498   Transcript: FBtr0238310
Sequence length 291
Comment type=protein; loc=scaffold_12875:join(19054057..19054095,19054166..19054399,19054461..19054848,19054910..19055124); ID=FBpp0236802; name=Dvir\GJ22385-PA; parent=FBgn0209498,FBtr0238310; dbxref=FlyBase:FBpp0236802,FlyBase_Annotation_IDs:GJ22385-PA,GB_protein:EDW62057,REFSEQ:XP_002050864,FlyMine:FBpp0236802; MD5=665e1b2907a1f78a5e5473aff31a3cf2; length=291; release=r1.2; species=Dvir;
Sequence
MPLTAESAAQQIQDRLKDIQQHIHKVDSERRRAESSIASLVRAQQSQTPNPKLKTLLQAK
ILEATQEEATIRAALAKIHEIRNIRNERRIQARNAGNKEAIRRGALMKMVQLSAQTLPLF
VGKPGERAPALCGAIPAESNYVAKVGDNVAALAKGIDEEENWILAEVVQFLHRQNKYDVI
DIDEEQKDRHVLSKRKVIPLPLMRANPETDGHALFPKDTVVMALYPQTTCFYKAIVHRLP
QTATEEYEVLFEDSSYLNGYAEPLPVAQRYVIAYRPTKKGAGSGSGNLSSA
Download sequence
Identical sequences B4LMG2
XP_002050864.1.90633 FBpp0236802 7244.FBpp0236802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]