SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0236854 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0236854
Domain Number 1 Region: 26-273,344-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.58e-99
Family Type II chitinase 0.00000341
Further Details:      
 
Domain Number 2 Region: 273-343
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.7e-19
Family Chitinase insertion domain 0.00058
Further Details:      
 
Domain Number 3 Region: 415-469
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000207
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236854   Gene: FBgn0209549   Transcript: FBtr0238362
Sequence length 469
Comment type=protein; loc=scaffold_12875:join(19786039..19786095,19786207..19787559); ID=FBpp0236854; name=Dvir\GJ22437-PA; parent=FBgn0209549,FBtr0238362; dbxref=FlyBase:FBpp0236854,FlyBase_Annotation_IDs:GJ22437-PA,GB_protein:EDW62152,REFSEQ:XP_002050959,FlyMine:FBpp0236854; MD5=004ef6f04e3b0b00c13d49013a3cb2e7; length=469; release=r1.2; species=Dvir;
Sequence
MRMYGEFVKYYFKTISQIQISPQSERVVCYQGTWSVYRPKEGKFGVEDIDPFLCTHLVYA
FLGIKESGELRIIDPYLDLEDNSGLGNIKKFNALKLKNPTLQTLVAVGGWNEGSKRFSIV
ANDPERRSRFIEQIVQFMQRHGFDGLDLDWEYPGQRHKLANNDRDNYVSLLKELKAGFDP
FGYTLSAAVGSAQFSAEISYDIPAIVEYLDFINVMAYDLHGSWDATVGINAPLFGGANAT
KQRDKQLNVDAVVKYWIGAGAPPEKLLLGVPFYGRTFTLAASDQHMPGVAHIGRGIAGPF
SREPGVMGYNELCRIFQQEQWTLEWEAVQQVPYAFKDRQWVGYENERSLMLKAEYALEHK
LGGIMIWSLESDDFRGSCGGNKYPLLTQINRVLFGMDSPTGLKAEPQPAAQGEIEDYRCQ
DNVGYVRDPHNCSTFYFCNAGKTFKFNCPTGLKFDYNSSSCNYSDLVKC
Download sequence
Identical sequences 7244.FBpp0236854 FBpp0236854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]