SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0236855 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0236855
Domain Number 1 Region: 15-245,314-360
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.11e-58
Family Type II chitinase 0.00013
Further Details:      
 
Domain Number 2 Region: 245-313
Classification Level Classification E-value
Superfamily Chitinase insertion domain 5.5e-18
Family Chitinase insertion domain 0.00072
Further Details:      
 
Domain Number 3 Region: 379-435
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000994
Family Tachycitin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236855   Gene: FBgn0209550   Transcript: FBtr0238363
Sequence length 457
Comment type=protein; loc=scaffold_12875:join(19789627..19789843,19789902..19790151,19790204..19791110); ID=FBpp0236855; name=Dvir\GJ22438-PA; parent=FBgn0209550,FBtr0238363; dbxref=FlyBase:FBpp0236855,FlyBase_Annotation_IDs:GJ22438-PA,GB_protein:EDW62154,REFSEQ:XP_002050961,FlyMine:FBpp0236855; MD5=799e4e0c547f5a18a80559d270ed9bde; length=457; release=r1.2; species=Dvir;
Sequence
MARNIAEIPKTIDSIFCHWNTAAYDRKKSSHFNLWSIDRRLCTHFVYGSVTTLDPKGSGA
MKIVNPRLVEKRAIFDSIENMRRDNFQAIISIGGTKDDAQRFSEMAASMPKRDQFYKSLI
KFLFKWNCSGVLLDWEYPTPEDRDNYVNLLSELKIILQDHQFLLLVSVSARMDDATLRSY
DIPRIANYADFIILNTHDNEDPYGPKVEYNSPLYGNGSRSVERGVRHWVEQSKISEKLIL
GIPLFGRTFTLEDASKTAVGAPSKGPGRQHDFSRQEGYMTYAEFCAQAVKWEKKYDKQAQ
VPYAYMDDQWITYENGHSISAKMHLAKEQRLGGAMMWSLDADDFHGLCGEHYGLLKVVVA
AIGSPDILTTKAPTTEGVGLCPEQGLFRHKWNCQAYYECRDGRRTDYECLDGEFFNEELG
QCKPSAEVKCIQNFVTWRPGQRGYSFLNLPLNLKVLE
Download sequence
Identical sequences FBpp0236855 7244.FBpp0236855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]