SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237053 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237053
Domain Number 1 Region: 28-84
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000023
Family Tachycitin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237053   Gene: FBgn0209740   Transcript: FBtr0238561
Sequence length 89
Comment type=protein; loc=scaffold_13047:complement(17619010..17619279); ID=FBpp0237053; name=Dvir\GJ22636-PA; parent=FBgn0209740,FBtr0238561; dbxref=FlyBase:FBpp0237053,FlyBase_Annotation_IDs:GJ22636-PA,GB_protein:EDW68263,REFSEQ:XP_002054743,FlyMine:FBpp0237053; MD5=f06f9906e3cf79a7315e7ca3ce5428ce; length=89; release=r1.2; species=Dvir;
Sequence
MATAHLPIQKYKYHEHNGEPGCQGLEEVNRMFRNFWDPTAYWMCDKQGTRARLQRCPKSQ
LYSEELGRCVHYTDWSWTEPKEPPSRPKC
Download sequence
Identical sequences B4M013
7244.FBpp0237053 XP_002054743.1.90633 FBpp0237053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]