SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237119 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237119
Domain Number 1 Region: 242-450
Classification Level Classification E-value
Superfamily MIR domain 7.32e-58
Family MIR domain 0.000000193
Further Details:      
 
Domain Number 2 Region: 451-621
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.18e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000688
Further Details:      
 
Domain Number 3 Region: 1218-1366
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.15e-36
Family IP3 receptor type 1 binding core, domain 2 0.0087
Further Details:      
 
Domain Number 4 Region: 111-218
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000241
Family MIR domain 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0237119
Domain Number - Region: 1393-1722,1851-1895,2037-2226
Classification Level Classification E-value
Superfamily ARM repeat 0.0127
Family Armadillo repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237119   Gene: FBgn0209806   Transcript: FBtr0238627
Sequence length 2835
Comment type=protein; loc=scaffold_13047:complement(16672135..16672701,16672764..16673195,16673255..16673419,16673476..16673648,16673890..16674012,16674069..16674261,16674415..16677213,16677279..16677502,16677565..16677823,16678894..16679528,16679590..16679616,16679690..16679834,16679896..16680049,16680112..16680267,16680330..16680505,16680567..16681765,16681843..16682635,16682701..16682816,16682877..16682947,16683877..16683977); ID=FBpp0237119; name=Dvir\GJ22702-PA; parent=FBgn0209806,FBtr0238627; dbxref=FlyBase:FBpp0237119,FlyBase_Annotation_IDs:GJ22702-PA,GB_protein:EDW68149,REFSEQ:XP_002054629,FlyMine:FBpp0237119; MD5=5fcfac277ef8e1bac5ffe431b036d692; length=2835; release=r1.2; species=Dvir;
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCL
IKICPMNRYSAQKQFWKAAKQSASSNTDPNLLKRLHHAAEIEKKQNETENKKLLGTFIQY
GRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYV
VVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHIL
KGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRG
GAGDWNSLYRFKHLATGHYLAAESESDVAAGTVAANAHESLLGDCSKDSGLSSTMNSTLN
EKPKGKLYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHATSIP
IDVDDDKPVMSKVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLAMVTSKLDNGSI
SINERRALISLLQDIVYFIAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQLFKIL
HGPFQEHSAGDGPFLRLDELSDPKNAPYKNIFRLCYRILRLSQQDYRKNQEYIAKHFGLM
QKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYLSDLC
VSNRKAIAVTQELICKSVLSDKNVDILIDTQIKALRGDAAVRCYKGASEDVCLATLTEVA
GDDEDRSDLQSNSTTSTWDSASLNGEAEKYEIHLQWKGQPSSRSMADLASSVADGCEQEA
AILNYYRHQLNLFSNMCLNRQYLALNRLSPQLDIDLILKCMSDETMPYELRASFCRLMLH
MHVDRDPQEPVTPVKYARLWSEIPSKMSIMDYDGKNLQPDQNKQACRAKFNTTIAFVENY
LCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSILDCVSETSS
GGGYVNADIESVEEETSNEAEGGVLRSIGDMSTVMTSLALGSVGQAIAAPAIALQQRKSV
SQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESEVLAQTQTGPNEE
QTPPATAGTTDSEQIAAAEAAMAAAAAAATAAAARQKNIDLESIGVQAEGIFDCERSDAA
NLDLDGQGGRTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVSDSD
VESYKQIKSDLDILRQSVEKSELWVYKAKATDELGVSEVAGGADSLEYDATLSPEQRGEY
QKVKEILIRMNKFCVTAGPIVRPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDVLMKELM
CLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKDNLALCNEVTDKVVQH
FVHCIEIHGRHVAYLQFLQTIVKAENQFIRKCQDMVMQELINAGEDVLVFYNDKTSFQHF
VQMMQQQQQRRQPLSDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICH
PLCMPEVKEAYVDFLNHCYIDTEVEMKEIYASGHMWSLFEKSFLVDLNLLVSNSTAAANK
TLLAYVLNGVTNLLGSFFSSPFSDQSTIVQSRQLIFVQLLQATYRLTQCKWLPLADRFNV
ETCIRTLTESAKMRSIVLPVELEQQVANMSSKTAMLTRQTAKWLLASKQPKYETQQSAQL
MRWDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFPAGTEARKRCESGGFI
RKLIKHTEKLLEEKEERMCVKVLRTLREMMAIDVNYGEKGDALRETLLLRYFQCKSAPKL
EDEHPHLPAAMAAAAAVAAAAATSDSAKQLHLVTHGPGAKYLARAGKTLHEMQNHLDREG
ASDLVVELVIKSVHSPNIFVEAVELGIALLEGGNPIIQKGMFQKFLSDDLNQAFFKVFFE
KMKDAQQEIKSTVSVNTTDIAAKAHEHKQDGNLELDKISRKHGLKSNGVVITDELKRELH
NAGLATARAYGNARNIHSGEESSAISVNSPLEDILAEKLEKHRDSKEQRNQLSNKVLVMQ
PILRFLQLLCENHNPDLQNLLRNQNNKTNNNLVSETLMFLDCICGSTTGGLGLLGLYINE
HNVALINQTLETLTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGENRMDLVLE
LKNNASKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELIDEQDDADEPSAA
TDDDDATVSPREVGHNIYILCHQLAQHNKELAALLKASEDPQSASFDAKTSQALMYYATH
TAQIEIVRNDRTLEQIVFPIPEICEYLTTDTKIKILNTAERDDQGSKVADFFDKAEEMFN
EMKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVINMIVAFFYPFDNTVPELSSHISLLF
WAILIFSLVIVITLPRESGIRTFIGSVILRFIFMLGPESTLCLLGVVTVTLKSVHIVSIM
GNKGTLEKHFLKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRS
VTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVPVDFEEQEAASTIGPLTLSVPASP
EESCAMPDELGVCNGGTKQQVAAAAAGSGEAKERSCDSLVMCIVTTLNQGLRNGGGIGDI
LRAPSSKEGLFVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCF
ICSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGIL
EWFPRLRAMSLAAVDADGEQIELRSMQAQLLETQLLIKNLSTQLHELKDHMTEQRKQKQR
LGLLNTTANCLLPFQ
Download sequence
Identical sequences B4LZB4
7244.FBpp0237119 FBpp0237119 XP_002054629.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]