SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237155 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237155
Domain Number 1 Region: 222-349
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-36
Family Pleckstrin-homology domain (PH domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 497-599
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-24
Family SH2 domain 0.0000412
Further Details:      
 
Domain Number 3 Region: 95-156
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.15e-18
Family Adapter protein APS, dimerisation domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237155   Gene: FBgn0209842   Transcript: FBtr0238663
Sequence length 765
Comment type=protein; loc=scaffold_13047:complement(16062516..16062866,16063401..16064729,16064807..16065415,16065831..16065839); ID=FBpp0237155; name=Dvir\GJ22738-PA; parent=FBgn0209842,FBtr0238663; dbxref=FlyBase:FBpp0237155,FlyBase_Annotation_IDs:GJ22738-PA,GB_protein:EDW68091,REFSEQ:XP_002054571,FlyMine:FBpp0237155; MD5=314003e23c32948b4b2824622ffdef7d; length=765; release=r1.2; species=Dvir;
Sequence
MSNHHGFQLGNSCIKLNLNGNSGPEPRHHPHRQQQQSFGHMGGNSAAANSNAFSAGGYIG
PTTSLGAAGGSDLIPAPMGTGTALGSTSFAYGGTSWEEFCDRHARVAASDFAKACINYIN
GNLPPEVARSIPHRSFAVKFVEYFSEHYDTEFFRRRSNLKTDIGSLLCDGGGDSGGGFDT
EEHEVSRLFPKSLLRRLSFKGLRKGKAFFHKNSDDVDGVGSSKQSSKTKLAKIVVECRKE
GIVNNLTAESLDQTTATQKWEKCRLALVKAVGGYMLEFYTPPKAPKPHSGVFCFLISEAR
ETTTLEMPDRLNTFVLKADNNMEYVIEAASADEMRSWLATIRYCMRTPPTQQPILNSDVI
AVAMQTSPVTTNPNPTTSTPSGALGGIQNPQYQQQGGLVLGGSNGNLVSSQSADSALAAI
SASNSNANAPAGGNDVNAISQASIELSSTPPEIPSRPSRGERGEQRLSASSNFDGTELVE
TESDVNVADLTAEMRLFPWFHGTLPRAEAARMVLQSEAAGHGYFLVRQSETRRGEFVLTF
NFQGRAKHLRLTISEKGQCRVQHLWFPTIQEMLEHFRHNPIPLESGGTSDVTLTDWVHHT
SRLNDGAPITTIAAAAHEPGADASAGASNAAGSSGHANGNGNGHPSPRHRNEVITMNLSV
RLKTNEIELPQEPTHVYFPEQVYFHLDPSTLTVHNSPPAGQGFLDQPHLRASNASLQATH
PGVATTRHAADTTGANSGAPGSSGSGGATGAECSGRAIDNQYSFT
Download sequence
Identical sequences FBpp0237155 7244.FBpp0237155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]