SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237377 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237377
Domain Number 1 Region: 48-97
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000178
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237377   Gene: FBgn0210063   Transcript: FBtr0238885
Sequence length 164
Comment type=protein; loc=scaffold_13047:complement(11853821..11854305,11854850..11854859); ID=FBpp0237377; name=Dvir\GJ22960-PA; parent=FBgn0210063,FBtr0238885; dbxref=FlyBase:FBpp0237377,FlyBase_Annotation_IDs:GJ22960-PA,GB_protein:EDW67650,REFSEQ:XP_002054130,FlyMine:FBpp0237377; MD5=03e0cdefba468bd2e9317705a2a54a6f; length=164; release=r1.2; species=Dvir;
Sequence
MLKVFLIFLGLLALSSATTLYTEAEESTSDPTDTTTAPEACLYERQPWASVNPSQYYICA
DNKPKLTNCNEGYYFVRNATLSGCIPAKKMNPNCVNLDVTVGPCTGINLKQPQASQVLTN
FWLCTEENAAPVELTCVDDKAFVKQEGYLGCFDWEVWRALRGCN
Download sequence
Identical sequences B4LWB6
FBpp0237377 7244.FBpp0237377 XP_002054130.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]