SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237496 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237496
Domain Number 1 Region: 22-73
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000837
Family Tachycitin 0.024
Further Details:      
 
Domain Number 2 Region: 134-188
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000157
Family Tachycitin 0.021
Further Details:      
 
Domain Number 3 Region: 409-466
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000246
Family Tachycitin 0.035
Further Details:      
 
Domain Number 4 Region: 244-301
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000445
Family Tachycitin 0.024
Further Details:      
 
Domain Number 5 Region: 526-577
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000157
Family Tachycitin 0.042
Further Details:      
 
Domain Number 6 Region: 302-354
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000131
Family Tachycitin 0.02
Further Details:      
 
Domain Number 7 Region: 465-521
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000251
Family Tachycitin 0.029
Further Details:      
 
Domain Number 8 Region: 579-632
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000133
Family Tachycitin 0.027
Further Details:      
 
Domain Number 9 Region: 78-131
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000228
Family Tachycitin 0.01
Further Details:      
 
Domain Number 10 Region: 191-242
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000034
Family Tachycitin 0.015
Further Details:      
 
Domain Number 11 Region: 358-412
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000994
Family Tachycitin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237496   Gene: FBgn0210181   Transcript: FBtr0239004
Sequence length 636
Comment type=protein; loc=scaffold_13047:complement(9766526..9768402,9768509..9768542); ID=FBpp0237496; name=Dvir\GJ23079-PA; parent=FBgn0210181,FBtr0239004; dbxref=FlyBase:FBpp0237496,FlyBase_Annotation_IDs:GJ23079-PA,GB_protein:EDW67440,REFSEQ:XP_002053920,FlyMine:FBpp0237496; MD5=9b2049d808e9fff44178066515afc8a4; length=636; release=r1.2; species=Dvir;
Sequence
MLSHPVWKNNNALNIDLDKRNECVEGAVQSHPDDCARYLQCLNSAIVIQACPNGSYFDAT
YEVCVIDVNGVCASASGKCSEDQIEVNPGNSCGYLRCINGSLKEEQCNIGSYFNASLSIC
EIDENGICSTFPGNCSEGELQKDPEDCAGYLKCINGSLFEEKCSNGSFFNITLKICQIDE
NGVCTPAPEKCLEDEIKEIPGNSCGYLRCINGRLEEEKCDIGSYFNSSLLICEIDENGIC
TNLPGNCSEGELQEDPGNCAGYLKCINGSLIEEKCVNGSFFNSTLKICAIDENGICSTNP
IKCLEGELEEDPKDCAGYLKCINESLIEEKCVNGSFFNSTLKICTIDDNGVCISTHEKCL
EDEIKEIPGNSCGYLKCINGSLEEEKCDIGSYFNSSLLICEIDENGICSSLPVCAEGQLE
EDPEDCSGYLECVNGSYIEKKCASGSFFNATLQTCEIDENGICFPIPAKCSEGELQVDPE
NNCGYLKCLNGVLVEMICANGSYYNSTLKTCLIDENGICLSAGNKCANHEVRHDPEDCSG
YLQCINGELVKKLCSYGSYFHTTLQSCVVDDEGICTPLSDQCEEGERETDPDDCAAYMEC
IAGDFIAQKCVNGTYFDVDIKACILDEKCVCITQAN
Download sequence
Identical sequences 7244.FBpp0237496 FBpp0237496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]