SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237729 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237729
Domain Number 1 Region: 388-490
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000851
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0085
Further Details:      
 
Domain Number 2 Region: 220-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000458
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.061
Further Details:      
 
Weak hits

Sequence:  FBpp0237729
Domain Number - Region: 145-205
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000538
Family HLH, helix-loop-helix DNA-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237729   Gene: FBgn0210413   Transcript: FBtr0239237
Sequence length 877
Comment type=protein; loc=scaffold_13047:complement(5488865..5490026,5490084..5490237,5490639..5490745,5490836..5491020,5494045..5494329,5497587..5497676,5499045..5499112,5501964..5502145,5511209..5511609); ID=FBpp0237729; name=Dvir\GJ23312-PA; parent=FBgn0210413,FBtr0239237; dbxref=FlyBase:FBpp0237729,FlyBase_Annotation_IDs:GJ23312-PA,GB_protein:EDW67014,REFSEQ:XP_002053494,FlyMine:FBpp0237729; MD5=de45025186212d155b3ddbb7695e6a42; length=877; release=r1.2; species=Dvir;
Sequence
MYADKRGLEKPGSTLSAAAAAAAAAAAAAVAVTHLATPTHAHALQQQQQQQHHHVLQLQH
QQQQQHLQHQQHHMQQHMHTHHNFQQHEPTTLSQQQHLQQQQQQQQQQQQQQQQQQQQQA
SQQQQQQAAGMFTRFDANKSTKGASKMRRDLINAEIANLRDLLPLPQSTRQRLSQLQLMA
LVCVYVRKANYFQQVFKRHNALHQHHQTATPNIGFSKALSGFLMMLTQNGKLLYISDNAA
EYLGHSMEDLLIHGDSVYDIIDKQDHATIQAELNRNVPPQPGGSSSSSNVGVGAGVGVGV
GDSTASNGTGGASSLEGEHRMFLCRMNVSRNARRQMRFGDQKVVLVQGHYLSFLPLCSRN
EPVFLATCTPIAMPETRECVVQGATNVFTTIHSMDMKIAHIDKNGEFHLGYDKASLQGTS
WYNLIHSENLREAQSKHRLITQSEQDRSCILLVRMQRSSGEYTWVHVVLQVRDSPDSTQQ
PVIVCTNQVLNDREASIMLANSWLYHYYTVQSKIQFGMPLDSAMRVPPGSSSTGYYSSHQ
QPHGGGATSVGLGISGATAGMSSVFGSHHAHHHHHHTTAATSYHHHHPHMGAAYGGVYHA
EGTLELKEDQQLYGYQSGTGPEPVDYSQVNGTPTGSSQKPTQSATPPPPKKRARNKLEPL
YLHAERSPAAAITPEPDCYALHPGAAYATAAAGVAASSSDATASVIYATIVPTRPRLLNK
TLPPDPADFIEQWNPSPPWSESAQKASLDSFGSSHELSPCITTTPPTPTSATPHHGGISA
QTIGPAFSFEWMSDPLVPVAYQQWSPATGDHHQHLSQHLAAAQQQHQQHQHQQQQQPHPQ
HTQLTLHGVHAERVELAAETMVGTGRADATEPVEDRG
Download sequence
Identical sequences 7244.FBpp0237729 FBpp0237729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]