SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237764 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0237764
Domain Number - Region: 33-59
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00366
Family Tachycitin 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237764   Gene: FBgn0210448   Transcript: FBtr0239272
Sequence length 61
Comment type=protein; loc=scaffold_13047:complement(4784957..4785142); ID=FBpp0237764; name=Dvir\GJ23347-PA; parent=FBgn0210448,FBtr0239272; dbxref=FlyBase:FBpp0237764,FlyBase_Annotation_IDs:GJ23347-PA,GB_protein:EDW66937,REFSEQ:XP_002053417,FlyMine:FBpp0237764; MD5=c5d247d852ce77c1fcf4a14805eb153d; length=61; release=r1.2; species=Dvir;
Sequence
MNFSWLCLVIFALFAGVVSAGKCPKDFKSENGQCISQRTIRGECPTGSTYKIGVNACVYG
A
Download sequence
Identical sequences 7244.FBpp0237764 FBpp0237764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]