SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237907 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237907
Domain Number 1 Region: 274-367
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.03e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0044
Further Details:      
 
Domain Number 2 Region: 126-178
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000123
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 35-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000131
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237907   Gene: FBgn0210588   Transcript: FBtr0239415
Sequence length 1099
Comment type=protein; loc=scaffold_13047:complement(1904395..1904970,1905318..1906226,1906295..1907142,1907209..1907713,1910100..1910189,1915649..1915773,1923758..1923948,1936631..1936686); ID=FBpp0237907; name=Dvir\GJ23490-PA; parent=FBgn0210588,FBtr0239415; dbxref=FlyBase:FBpp0237907,FlyBase_Annotation_IDs:GJ23490-PA,GB_protein:EDW66688,REFSEQ:XP_002053168,FlyMine:FBpp0237907; MD5=0818409aeeb169e0c064cdf45a5fcd80; length=1099; release=r1.2; species=Dvir;
Sequence
MSQLGTVYATKRRRRNGKSLKPPPKDGVTKSNPSKRHRERLNAELDLLASLLPFEQNILS
KLDRLSILRLSVSYLRTKSYFQVVMHKDKEENGVLPHIHAHDGYRTRELGAFEHGLLDGD
MFLQALNGFLMILTCEGEVFFATHSIESYLGFHQSDIVHQSVYELVHSEDREELQRQLLW
NSFLPADMSSMQLSETLAPDKALYLERSFTVRFRCLLDNTSGFLRLDIRGRIKILHGQNR
KTEEPPLALFAYCTPFGPPSLLEIPHKENMFKSKHKLDFSLVSMDQRGKHILGYADAELV
NMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRYQKKDGEWQWLQTSSRLVYKNSKPD
FVICTHRQLMDEEGHDLLGKRTMDFKVSYLDTGLASTYFSEADQLVVPPTSASVSPTAHA
LPPPVTPTRPNRRYKTQLRDFLSTCRSKRKLQQQQQQQQQQLQAQQSSPLAQVGSPAPAV
VEYLPDPAAAVAAAYSNLNPMYTTSPYATAADNLYMGSSMPANAFYPVSENLFHQYRLQG
AVGVGGYYTDYPHTGGPASAYVANGFLSYDGYAIASKAQDDKWQETGKYYSGYSSGYGSP
TSTPQQIPLKTPKSSPQVMEVISCSSDGPSPVAVAGAGVGAGVGATPNGSNVTPKVELAA
ATAAAAGQDPYERQTVLMWGTTQSSGVPLNSRITARAGGSPQRTTPLTNGLSYAHNNNNN
EHEPAAAAKWNGNKELTGKSTSAGTPESYQLQHDDSGLYSASSHTTSPQQQQQQQQQQPH
SSRGLGSNVSSSSNSITHPVSGTEHPTLQASHAHPHAQQQQQPHPQPPSCAGSLQQPQQQ
QQQQQPHSIHAHPHTQQQQQHQQQQHHHQHQPQPHPHPHHQHHHEANAAAAAHHLHPQAS
AGTANGSEILINTQLQQQQQQHLQQQQQQQLVGYTLHHHPLDSPPHCRTPPTLPAVSSLL
SGATSTDSSPYQQLAIVSSAAATASAPPPPPLIICADESLQALNSSSNGSSEAHISSTSS
SAARGARKSAKVQQQQHQQQQQQQQHQPNYQQHHAQHLLYPANITAHTALAYAPPPSGAY
IDGSPLLSFSEVTNTLLNQ
Download sequence
Identical sequences FBpp0237907 7244.FBpp0237907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]