SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237910 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237910
Domain Number 1 Region: 35-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000157
Family Tachycitin 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237910   Gene: FBgn0210591   Transcript: FBtr0239418
Sequence length 616
Comment type=protein; loc=scaffold_13047:complement(1885155..1886564,1886625..1886746,1887344..1887494,1887559..1887648,1891276..1891353); ID=FBpp0237910; name=Dvir\GJ23493-PA; parent=FBgn0210591,FBtr0239418; dbxref=FlyBase:FBpp0237910,FlyBase_Annotation_IDs:GJ23493-PA,GB_protein:EDW66686,REFSEQ:XP_002053166,FlyMine:FBpp0237910; MD5=ee44161d8398bdabfa0d62f08c09d0ac; length=616; release=r1.2; species=Dvir;
Sequence
MPSVLNNFQLGALALLCFTALFFSSECQNGLNAQKTSFSCTGRPAGYYADVETGCQVYHM
CDGLGRQFSYTCPNTTLFQQRMLICDHWYMVNCSKAESNYAANLLIGQRDKPFVNDEENN
LRTPRPDLLDRPYAPDYSGESFRSQYKQLTPSQNQIRDDSNKGAAKFESQLAQNGQTRWR
IPPPSRTILPPAYEPQIEVASSTPRAKPIITTSRTTTRRPASVAPVLHKRTEALHQRIAD
PDTDDLGTSHSTRYNTSADFNSAEQPATKNTTKLVKFIKAPSKIYEPPFVYPIYNQDELQ
PATETLRTSSAAPFSTASTQTRFTAAAAGPSTTARPLSRPTTYAGQPFSYSTLATTASTA
INYRPAVAQTEHRTPTPAQAFRPATPTSTSAPKVAAKAELPFNDLLPPFVEFVPHDIATT
QGPPIYYEWKVPANGLQPPKLDPPIGVDGREYPETTGDYSVKTKQDSFNSKLNDIASHGS
AAVAPKRLPISRSIKPNELPMMAAEKAQRRADVVSASASSTSTDITQLRKQLLIPEYAFP
LETIGRTGYAPGSSAAGDLYNSFQLKIPERRAGTNGGSSSSSSSSTHGRWFGENPKCPEC
HPSFVLPGTCQPCLRR
Download sequence
Identical sequences B4LWW5
7244.FBpp0237910 XP_002053166.1.90633 FBpp0237910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]