SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0237994 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0237994
Domain Number 1 Region: 1061-1322
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-81
Family Protein kinases, catalytic subunit 0.00000156
Further Details:      
 
Domain Number 2 Region: 13-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.84e-39
Family FCH domain 0.012
Further Details:      
 
Domain Number 3 Region: 959-1088
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-24
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0237994   Gene: FBgn0210674   Transcript: FBtr0239502
Sequence length 1333
Comment type=protein; loc=scaffold_13047:complement(606395..606546,607004..607186,607254..607382,607440..607526,607610..607823,607884..608258,609579..611165,611371..611548,611613..611891,612064..612400,612468..612564,634703..634890,637027..637222); ID=FBpp0237994; name=Dvir\GJ23577-PA; parent=FBgn0210674,FBtr0239502; dbxref=FlyBase:FBpp0237994,FlyBase_Annotation_IDs:GJ23577-PA,GB_protein:EDW66516,REFSEQ:XP_002052996,FlyMine:FBpp0237994; MD5=719c1857e01ef0fb8d56f4b1287d7e77; length=1333; release=r1.2; species=Dvir;
Sequence
MGFSSALQGRAAHEALIVRQDAELRLMETMKRSIQMKAKCDKEYAIGLTAVAQQGLKIDR
ADEMQGSLISKSWRSFMDELDQQAKQFKFNAEQLEVICDKLSHLSQDKRKARKAYQEEHA
KIAARLNHLTDEVVRKKSEYQKHLEGYKALRTRFEEHYIKAPGRSGRKLDDVRDKYQKAC
RKLHLTHNEYVLSITEAIEVEKDFRTVLLPGLLEHQQSVQESFILLWRNILLEAAQHGDL
TADKFKEIQKRIDTVISSINPTEEYGEFTEKHKTSPTTPLLFQFDETLIEDIPGKLTAST
LTVDNLTVDWLRTRLVELESAVKECQERQLKMIEHVNGGSPVANGSVISNGSSASNGIQS
NKDSQNRQSKDLNALRCQEKQKQKLVDMIKCALNEVGCEELPSGCDDHLSLEQNFIEHGF
NNEQQRSNSTNSPGLGIMNELMRRGGVLTLLRGRGRHFKRKSTPQPTTPMARARQGRFSK
LQPRSQSLGSLSVITDARSPARYEPVTNPLRLTVSVHYLGEEIVLSATPPALPRLRRTQC
SMLCLGEDDQPLEPLPVASTEPTPLNKLTNAAITNTNNNHIYADLELDNKPPSALVDADA
DSIVSESDDLAVKRHQIEIEINQVESNESQPAPQGSIDAHLDQIDELNRVLDDRLKRSMQ
PTTAGDVNAIESADDIPVQSRQDDPDTGMQANRSSSSSSECRSSQLSSKEGGQSKKRSVS
FTQKSISNIISNIREFSKSPLARMTKNATLNEKPDTSRQPREPSQLSNSSESHTQLSNSN
SIHNNNNNNRDPCQSTIITSTITTTITTTSTTTPAKETSRLKFKVPKIQKKSKAIRNTFR
TKLLSFQMRRSKPCKQCTKRRRIHPSKSVFDFAKEFETNPLEQAGLEQFCSCPAPAQKTK
AKAKRMSCQNERSFEVHSSEELDDEEDDANDDSSSDDVLSIKEHCYCVPSLAASLSLSTN
RPLYEEEWFHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGD
GHFRFEGPPFPSIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLEKIGRG
NFGDVYKAKLKSTKQDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQ
PIMIVMELVPGGSLLNYLRKNSNALSTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCL
VDFEHSVKISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWE
IFSKGDTPYSGMSNSRARERIDTGYRMPTPENTPPEMYRLMLKCWAADVESRPHFDEIYN
VVDALILRLENSH
Download sequence
Identical sequences B4LW11
XP_002052996.1.90633 7244.FBpp0237994 FBpp0237994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]