SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0238495 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0238495
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.69e-18
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0238495   Gene: FBgn0211163   Transcript: FBtr0240003
Sequence length 181
Comment type=protein; loc=scaffold_13047:8332954..8333499; ID=FBpp0238495; name=Dvir\GJ24078-PA; parent=FBgn0211163,FBtr0240003; dbxref=FlyBase:FBpp0238495,FlyBase_Annotation_IDs:GJ24078-PA,GB_protein:EDW67304,REFSEQ:XP_002053784,FlyMine:FBpp0238495; MD5=b63545a4b706d824260f6ea16eb50ac3; length=181; release=r1.2; species=Dvir;
Sequence
MPHHNIVCEWLRTIGLPQYGESFLENGYDELEICKQIGEIDLDAIGVDNPTHRGKLLKSV
RALREKGAAIVYVLINDPKALSNSNEILASDCDTPITMKELEGVMKRHLEADGIRLTAHP
YSSPVSTRHHEHHGHHQLAPASTGLSWTFYLPLAICMLSMGDLLSCLVVVVAIPAACDSR
R
Download sequence
Identical sequences 7244.FBpp0238495 FBpp0238495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]