SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0238645 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0238645
Domain Number 1 Region: 345-403
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000706
Family Tachycitin 0.039
Further Details:      
 
Weak hits

Sequence:  FBpp0238645
Domain Number - Region: 227-295
Classification Level Classification E-value
Superfamily Major capsid protein gp5 0.0144
Family Major capsid protein gp5 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0238645   Gene: FBgn0211310   Transcript: FBtr0240153
Sequence length 499
Comment type=protein; loc=scaffold_13047:join(11158892..11158934,11168485..11168618,11168674..11168985,11169043..11169477,11169531..11169686,11169750..11170169); ID=FBpp0238645; name=Dvir\GJ24228-PA; parent=FBgn0211310,FBtr0240153; dbxref=FlyBase:FBpp0238645,FlyBase_Annotation_IDs:GJ24228-PA,GB_protein:EDW67579,REFSEQ:XP_002054059,FlyMine:FBpp0238645; MD5=3936c1db43eb3250f73e4a13e431ee77; length=499; release=r1.2; species=Dvir;
Sequence
MNFFVIGFLIMQAASLSVGDELGFKESLGNVESDRRRAISYRNGAPELVGVLPSARQQEA
SAPVQHALPDKRISSRSTGPGPYNLQLLQQAVAKSQAQQQAQLMTEARPLPLGVPAFRPI
PQKATANEPLATSPVGAQRRLAVDTTQPRVSVNNKLVESHVKPHSNRTFHADNPMVAQPI
LSQPVAVPVFQAMPESIARIANVGKEDVALPEQRTLAKHPNYLQFEEPKFDLKDVTVEEL
AAAANVTVETIKHAIYVREQQLKAEHRAMLASKLRQEFMRTSTVKTTTTTTTTTTPRPRQ
LAEHKVSKVMNAPKEYYPVGYDKNFDDNFKSKVDLPPTSFSCARQKHFPGLYADTDLGCM
VFHVCALTDDGMVRKSFLCPENTLFDQTILKCNWWFYVDCSSSTSVYDSNIPISKSYQLM
KSLTYFSKYNNQKGDQDGDKDENAVDIDTLRESMEGVSRRLEQAKNAQAQLDEVEQSPQP
KAEHEHVVPEGESQQQLSN
Download sequence
Identical sequences FBpp0238645 7244.FBpp0238645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]