SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0238680 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0238680
Domain Number - Region: 38-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000262
Family Antifungal peptide scarabaecin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0238680   Gene: FBgn0211344   Transcript: FBtr0240188
Sequence length 102
Comment type=protein; loc=scaffold_13047:11845897..11846205; ID=FBpp0238680; name=Dvir\GJ24263-PA; parent=FBgn0211344,FBtr0240188; dbxref=FlyBase:FBpp0238680,FlyBase_Annotation_IDs:GJ24263-PA,GB_protein:EDW67649,REFSEQ:XP_002054129,FlyMine:FBpp0238680; MD5=4921c0e7423cf40c60696b1965cbc95c; length=102; release=r1.2; species=Dvir;
Sequence
MNYLYLFALCLALVSCSIAIPLGKPTGQPGCQTEAEIAVGAYRHYYLKNQYWVCHALGVP
ASLATCPVAQAWLDDAKACVYFAQWYWTPTVAPPSQPLAAGI
Download sequence
Identical sequences B4LWB5
FBpp0238680 XP_002054129.1.90633 7244.FBpp0238680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]