SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0238681 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0238681
Domain Number - Region: 114-146
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00575
Family Antifungal peptide scarabaecin 0.081
Further Details:      
 
Domain Number - Region: 34-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0194
Family Antifungal peptide scarabaecin 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0238681   Gene: FBgn0211345   Transcript: FBtr0240189
Sequence length 162
Comment type=protein; loc=scaffold_13047:11857022..11857510; ID=FBpp0238681; name=Dvir\GJ24264-PA; parent=FBgn0211345,FBtr0240189; dbxref=FlyBase:FBpp0238681,FlyBase_Annotation_IDs:GJ24264-PA,GB_protein:EDW67651,REFSEQ:XP_002054131,FlyMine:FBpp0238681; MD5=7893221d8abffc406282228ec291b7aa; length=162; release=r1.2; species=Dvir;
Sequence
MMPMMMMLMIMMLMLLRIADASVAATNATCKHATNMWGDPNPNIFYVCSVADQMPLQLHC
PQGRGYFNGHGHLGCLPYDQWPACRPTMELVAAQLAAGCNSSESNAKDQPWATLDPNQFY
MCPGVNSAPLLLSCAPGKGFVQTVGCADWSLWRRQMQCEAYY
Download sequence
Identical sequences FBpp0238681 7244.FBpp0238681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]