SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227231 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227231
Domain Number 1 Region: 113-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-33
Family cAMP-binding domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 243-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-30
Family cAMP-binding domain 0.00000218
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 3.01e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227231   Gene: FBgn0200049   Transcript: FBtr0228739
Sequence length 376
Comment type=protein; loc=scaffold_13049:join(1725056..1725229,1744802..1745161,1745247..1745621,1745700..1745836,1746391..1746475); ID=FBpp0227231; name=Dvir\GJ12814-PA; parent=FBgn0200049,FBtr0228739; dbxref=FlyBase:FBpp0227231,FlyBase_Annotation_IDs:GJ12814-PA,GB_protein:EDW68627,REFSEQ:XP_002046285,FlyMine:FBpp0227231; MD5=3c6d56e6e44de3f7a52af3caaccfb800; length=376; release=r1.2; species=Dvir;
Sequence
MSYMMAKTLEEQSLRECEHYIQSHGIQRVLKDCIVQLCVCRPDNPVQFLRNYFQKLEREQ
VKLDASKQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDAANYVKKVVPKDYKTM
NALSKAIAKNVLFAHLDESERSDIFDAMFPVTHTAGENIIQQGDEGDNFYVIDVGEVDVF
VNSELVTTISEGGSFGELALIYGTPRAATVRAKSDVKLWGIDRDSYRRILMGSTIRKRKM
YEEFLSRVSILESLDKWERLTVADSLETCSFEDGETIVKQGAAGDDFYIILEGCAVVLQQ
RSEGEEPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADI
LKRNITQYNSFVSLSV
Download sequence
Identical sequences B4LB63
XP_002046285.1.90633 FBpp0227231 7244.FBpp0227231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]