SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228736 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228736
Domain Number 1 Region: 31-90
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000173
Family Tachycitin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228736   Gene: FBgn0201533   Transcript: FBtr0230244
Sequence length 92
Comment type=protein; loc=scaffold_12822:complement(839722..839990,840055..840064); ID=FBpp0228736; name=Dvir\GJ14319-PA; parent=FBgn0201533,FBtr0230244; dbxref=FlyBase:FBpp0228736,FlyBase_Annotation_IDs:GJ14319-PA,GB_protein:EDW58392,REFSEQ:XP_002058424,FlyMine:FBpp0228736; MD5=db3ce5beba3c5055ea34c2c16c53426e; length=92; release=r1.2; species=Dvir;
Sequence
MKAVFVLCAVLAVVVVAVNADAGRSACKDESEIGQTYPHHFDPAKYWLCETLDKPATEVD
CPHGLAYMHLLKECIPWASYIWKKPEMPPTVA
Download sequence
Identical sequences FBpp0228736 7244.FBpp0228736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]