SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0230322 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230322
Domain Number 1 Region: 112-201
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 2 Region: 280-351
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230322   Gene: FBgn0203092   Transcript: FBtr0231830
Sequence length 661
Comment type=protein; loc=scaffold_13042:2576051..2578036; ID=FBpp0230322; name=Dvir\GJ15905-PA; parent=FBgn0203092,FBtr0231830; dbxref=FlyBase:FBpp0230322,FlyBase_Annotation_IDs:GJ15905-PA,GB_protein:EDW66219,REFSEQ:XP_002058111,FlyMine:FBpp0230322; MD5=7a7d5ef137dc3d063f24434b2ab72e7f; length=661; release=r1.2; species=Dvir;
Sequence
MSSRRSRRGNAPRWPADAADGPGGAQGEHCLEWVSMQKIARKLDGDVAELHIESFKVQRH
WLEQLLRKEGLSGARVFFESIMSRTRTYVCWPSRLKIGAKSRRDPYVRVVGGSSEQVIRA
KQRILSRLEERASRVLLKMDISHTDHTFMIGCGGSGIKRIRDLTSTHIHFPDEMQNFAEP
SNQVSVSGNLCQVEQARAMLRLSTPLLLAFELPVAQPRPYSTRYLRMIESSYNVQVIYSE
RARLYFSVMLVKGVEREAEKLRDATQLLMNFTWSSAFRDAPVKLYMEITSQHHLVIRGLH
NLNLNRIMEYTQTRITLPELCCPQLNPTDASHVAISGGIDNVYRARQLLLGNLPVTLKFD
YASSHQFLACHLMELNIKYGCHIVLLQNQRQRTVIIKGLEKYASKIYEARRDILRLDYLS
VRAQIPDTYFLPGDQNLSLAQRTQLASLLAGQWDSVAYVRHHNEPGRNGHQLFAPFRRAS
GPNDEEQLLHPTVPASCTLCSRNEAVGAGPSNGKGLASPNLAEEQQKYQPKRPAYAQEPA
PVYWVCPIVGEDMFDLDSEDDPVRPDSPEYPLYREWYEPLSLWSMPGEEQPIAVYRELRP
NQEPHIQLDLAHMPTFPTDPPPADSQWNHWFLHGWLKETSVRNRSLTRSASTSHCTQLKW
S
Download sequence
Identical sequences 7244.FBpp0230322 FBpp0230322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]