SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231417 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231417
Domain Number 1 Region: 198-439
Classification Level Classification E-value
Superfamily vWA-like 1.27e-82
Family Integrin A (or I) domain 0.000000408
Further Details:      
 
Domain Number 2 Region: 436-526
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-20
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 709-792
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.96e-17
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 619-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Integrin beta EGF-like domains 0.0092
Further Details:      
 
Domain Number 5 Region: 50-100
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000152
Family Plexin repeat 0.0067
Further Details:      
 
Weak hits

Sequence:  FBpp0231417
Domain Number - Region: 664-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family Integrin beta EGF-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231417   Gene: FBgn0204177   Transcript: FBtr0232925
Sequence length 865
Comment type=protein; loc=scaffold_12928:join(6389685..6390240,6390366..6390594,6391754..6391838,6394358..6394792,6394859..6395053,6395568..6396599,6396658..6396723); ID=FBpp0231417; name=Dvir\GJ17000-PA; parent=FBgn0204177,FBtr0232925; dbxref=FlyBase:FBpp0231417,FlyBase_Annotation_IDs:GJ17000-PA,GB_protein:EDW62763,REFSEQ:XP_002057277,FlyMine:FBpp0231417; MD5=479198eb53807487d6e2f65dabb8d5fb; length=865; release=r1.2; species=Dvir;
Sequence
MLQPQLLQMLQVALLCILASTATHWPATVAQQQSTLASQGSQQSPAKLEQNPCVNKVTCH
ECIQTQNCGWCMKPDYGDRPRCFLHTPKAEVCPEQFIWNPDTSERILINKDLTLASGGAA
WAGGQYVSGGSYQSSSAHGQSSSSGSYGASGSSSSYGASSSSCSSSGFSSSSVPPLSSSW
RAAAADEVHNLDVSYSQAEDYPVDLYYLMDLSKSMEDDKEKLSALGDKLSETMKRITSNF
RLGFGSFVDKVLMPYVSTIPKKLEHPCDNCKAPYGYRNHMPLSNNTESFSNEVKQAAVSG
NLDAPEGGFDAIMQAIACRQQVGWREQARRLLVFSTDAGFHYAGDGKLGGVITPNDGECH
LNGQGMYTHSIIQDYPSISQINQKVKQNAINIIFAVTQNQYSVYQKLSGHIEGSSSAILS
NDSSNVVDLVREEYSKISSSVEMKDNAMGDVKITYLSSCLTNGPQIKTNKCSGLKVGDKV
TFTAQITVTKCPANPRDWNQVIQIYPVGINESMIIDLEMLCSCPCEHAGSTGYEIHSQKC
HNHGTYMCGICECDEQHFGNTCECSLLDVHLNNANVNMCRPGNDTSVAECNGRGSCVCGE
CECHKRANPEEIITGKYCECENFSCERRKNLLCSGPDHGICECNRCVCKPGWTGNSCDCQ
TSTDTCMPPNGGEICSGHGTCECGVCKCKSTDDGRYSGKYCDKCPTCSGRCHELKDCVQC
QMYHTGELKNGDDCAKNCTTFTPVGVEKVKIDEHKDEQLCVFFDEDDCKFTFKYSEVGEL
VVHAQEEKECPPKVFMLGIVLGVIAAIVLIGLAILLLWKLLTTIHDRREFARFEKERMNA
KWDTGENPIYKQATSTFKNPIYAGK
Download sequence
Identical sequences FBpp0231417 7244.FBpp0231417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]