SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0231962 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0231962
Domain Number 1 Region: 5-379
Classification Level Classification E-value
Superfamily Serpins 4.71e-110
Family Serpins 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0231962   Gene: FBgn0204715   Transcript: FBtr0233470
Sequence length 407
Comment type=protein; loc=scaffold_12823:complement(1710165..1710373,1710439..1710580,1710642..1711514); ID=FBpp0231962; name=Dvir\GJ17545-PA; parent=FBgn0204715,FBtr0233470; dbxref=FlyBase:FBpp0231962,FlyBase_Annotation_IDs:GJ17545-PA,GB_protein:EDW58807,REFSEQ:XP_002059395,FlyMine:FBpp0231962; MD5=4948a27c9ca0a3edfd815c045b102598; length=407; release=r1.2; species=Dvir;
Sequence
MSVCQDTYNDFARELYDVATRNGASPSCIPGTNAIISPISVQTSLMLVFVGAAGRTENEL
RTGLKLGPGDRQEIAKSYHGFWTQLCNYGNKMTLKTVNRLFVNHKLKLQHEFKELADDYF
HSQPVALNFADATKATQQINAFVEQATENKIRDLLQPDAVNAETSAILINALYFKGLFQK
PFMPESTMPDDFYLEQNKRVTVDMMYQEDKFKYAELPELSARAVALPYEDSDISLLILLP
NKICGLQELERRMANLSLVNIDQHMRTEDVELALPKFSIEYDLDLKDTLQQLGISELFGD
TANLSRLFEEAAGQKISAAKHRGYIDVNEAGSEAAAVTFLKVVPMSLNMHKKTFKVDHPF
MFFIRNSRAVFFAGRFVSPQKKEFIMSSPAPACSDSMRMHVEEMSVN
Download sequence
Identical sequences B4ME42
FBpp0231962 7244.FBpp0231962 XP_002059395.1.90633 XP_015024225.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]