SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232255 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232255
Domain Number 1 Region: 1599-1996,2057-2089
Classification Level Classification E-value
Superfamily Serpins 6.94e-55
Family Serpins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232255   Gene: FBgn0205006   Transcript: FBtr0233763
Sequence length 2094
Comment type=protein; loc=scaffold_12823:complement(825504..831788); ID=FBpp0232255; name=Dvir\GJ17838-PA; parent=FBgn0205006,FBtr0233763; dbxref=FlyBase:FBpp0232255,FlyBase_Annotation_IDs:GJ17838-PA,GB_protein:EDW58753,REFSEQ:XP_002059341,FlyMine:FBpp0232255; MD5=baffc74724cf33feb8ca1ccb36568de4; length=2094; release=r1.2; species=Dvir;
Sequence
MTMQEIQSIVANGDGEGPSIIHTAPLLEHEPEKKVQDIVDSVQNVLNKEVASSSSKNSSG
ELLPVLDTPDVSSSWSLILPAIFGNTGGDIFPQQKPQQIVMTPESEVLDTSTRAAPTTQR
ATKKPKPAKRKPGNRRKPSTSTTEMTPQVVQEDLDPLESVYTGIQQYQQAAANMHDFDIA
HMEPIYQKLPSTTARPETTTRRVFYNNQEIVHTPSASNTTTEQQHQLAKKPGNVHRKPTQ
PHRVKKPSGSTSSTTQPTGGKQKVKKKPTTSTTSTTSTTTTTTTTTSAPPANAPAETTTA
APETTTTTQAPVSTTPKKKKRKPTRTPGHTGNNGGSSSKPSKPKRKPTTKPKPQQHQHHQ
VPEQAAAATAPQQQEVSTVKPARPHRPQKKPKPTTSTSTTTTTTTLPPSISSTTTVATEP
TAPQHESAESAAPHESEQQEPVHHKPVQHEPVHHKPAATTTTTTTVAPRTTTTAATTTTA
ATSTTAAPSSSTSSRRPPTLHYEKLHGKPAHASTTSKRPTTLHHQKIHGKPVHSAATTEA
SKLADIYGHINANPVKSTTTTTSTTHAPVYPVPSYDAEATENLPTIVAVQETIEADKTQL
KKTPLPLPSLAVLQQQLQQSAPPPHQAAQLSAVQMLSMDQIVQSLTQDLLAGDKKNDNAA
PVKYDSADSKEQMETLANNKKVSISSSTTTSTTTTSTTTTTTTTAAPRISTTAATTPKPL
TAHYGGSTLATMLDEEGTSTNEDKEESNEQQTTLSSMEVGAGQEEQTPIVLITARPQYFT
TNQAPAQPLLSTANPEPETTELPSHMQFLLTTPMAAYDESEMEAATTDKPAAEANHVVKF
EPLYADVPEAVVAELTEQPETNEETTTEISAARLPVTDRTTSTTNADEEDSTEVTPMIAN
LVQQLNLEVLKPTDQISMGNFQTQAATVASTLVDGSNTLVSDIYMNSNETKDELQFLMSD
VIQQITQDDETYKPADDSHRLTNFAQLNTSFLLPPRPSTTEEPTKLATEQEITTVRPSQE
EHSKQEAEYINTPAPGPALMESSTWRLPVLSLSQIYAQQQQDEDDDEQQLFDSERIELLK
PAEAADKQEVIDENNTKEQQQAEKQKQTDTQQQAENQEEKHEEEHQQQEEKQQQQLEEQQ
KEQQLEATTMPITDTTEAATAATTEQVQQAEESSKETSLPEEVTTVSGVEQLHDEKPDAP
ERDSEEQMPEMLTNGYNEQIQAEATTEQLEADTTEQVPAVEELATAATTTTTAAGSTNVY
QDTQEQTSSEKEQQQTEKSEEDAKTEEVMEEEPMQSVEDSATNAAQLQPQYSTQPAAVEE
QEEDKEKSGQQQQQEQSTTNRGELATEIPGDMSVVSSESDMSLSSEQVTEKLELSTVRTM
DLNEEALEDISDELTATLTEEDTTSAQQYTLDDEDPYVKLGETTASVVRPQHLDSTEDKS
TPNQSVEQQQQQGQQIYKVEQEQSLEQEPEPQTNYHLTLPLASYGNQQADEEDDEDQTDY
QLPMLLPSSSTTEKAATTTSSTTTPKPTTITSTTSSPTISTTTKRLHTLKPVSYYVQPSL
LGGYNQLEPQPPKVLPYNANTNNLGQRPMQRPASLTNLMAASTQATRPPVKLEPSPQSSQ
GLEASTARLDEDVLSFARLCNELAFSYWKAITSEKISSARSLVISPFALTSMLSMVFLGA
RGSTSGEMNEILKLDDMVSFNPHLIFRNITNSVEQSMESDIATAAFVREIFSDRANGKIL
PFFKEKTQQLYGGHVEEVNFHVVNDIVRRRTNLLVKRHTMGKVLEYLRTNSVWVNGPLAT
VSANLFQTDCSRGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFTAGYEPKLDATVV
AFGRIQDTVSTIYVMPGHQSSVSPTDNLDRLERNLVELAFGQGNAWSNLLTSLMDRQGME
VQLPRFSHRSFVNASLGLQKMGLKGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCG
EEKISDHHHVEMYPAPPLRKRNKDVDATDDDAYDSSEAIVDFGSLVQESALGRGFYDDLL
DPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILFMGRFNPRLLP
Download sequence
Identical sequences 7244.FBpp0232255 FBpp0232255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]