SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0232468 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0232468
Domain Number 1 Region: 146-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 321-390
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Weak hits

Sequence:  FBpp0232468
Domain Number - Region: 105-163
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0098
Further Details:      
 
Domain Number - Region: 263-308
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.076
Family Eukaryotic type KH-domain (KH-domain type I) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0232468   Gene: FBgn0205216   Transcript: FBtr0233976
Sequence length 873
Comment type=protein; loc=scaffold_12723:complement(1872889..1873248,1873303..1874234,1875776..1876157,1876212..1876337,1876561..1876887,1876974..1877053,1877127..1877196,1878425..1878474,1878532..1878826); ID=FBpp0232468; name=Dvir\GJ18051-PA; parent=FBgn0205216,FBtr0233976; dbxref=FlyBase:FBpp0232468,FlyBase_Annotation_IDs:GJ18051-PA,GB_protein:EDW57610,REFSEQ:XP_002057537,FlyMine:FBpp0232468; MD5=3cef3b2e085ce45f094feec810cbd120; length=873; release=r1.2; species=Dvir;
Sequence
MLSCAPFNKLIYPTAADISAMASAKATPVAVGLTTLSLPTGPAGASGAPSETQSEISSVD
SDWSDIRAIALKLGVQNPDDLHTERFKVDRQKLERLIMADSAIEGMNGAEYFFDDIMNTT
DTYVSWPCRLKIGAKSKKDPHVRIVGKVEQVQRAKDHILGSLDSRGTRVIMKMDVSYTDH
SYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLDGVERARALVRLSTP
LLISFEMPVMGPGKPQPDHETPYIKMIESKFNVQVIFSSRPKLHTSLVLVKGSEKESAQV
RDATQLLINFAFESIASQILVNVQMEISPQHHEIVKGKNNVNLLSIMDRTQTKIIFPDLT
DMNVKPLKKSQVTISGRIDDVYRARQQLLGNMPVALIFDFPDNQTDASEIMGLNLKYGVY
ITLRQKQRQSTLAIVIKGIEKFIDKIYEARQEILHLTTPVIKPEIPDHYYMPKDKDVSLA
YRSQLTALLAGYPDSPKTPSLLPPTMGGQLTPYGNKAHMLLAANVGVGLTTPTGICAPTQ
KYMQLHNSSYQPRQVSTMNNLSNCSNNNSSNNNNNNNSNNNNCSSNNNNNISNNSNNINN
NNNNNISNNNNYLQVPGSGLLKPPPAPMPSTNVGPPPTVGVNLSPRNSCSQNTSGYQSFS
SSTTSLEQSYPPYAQVQAAVSSTSSSSAGANRAHYSPDSTYSSEAGSIAGAAARLGRRLS
DGVLLGLGNATGGGAHLLPGSAESYRNLHYDLAAQQQQQQRAFDFDMKRALGFKAMERTP
VAGELRTPTPAWLGMGLSRTSPAPIETVDDGIGNAGNGWRMPPPPPGLGSPYGLSATTGL
LDATPVSRRMQLSQHKDIHTLLTSLGLEHYISE
Download sequence
Identical sequences FBpp0232468 7244.FBpp0232468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]