SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233259 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233259
Domain Number 1 Region: 325-609
Classification Level Classification E-value
Superfamily Kelch motif 6.67e-77
Family Kelch motif 0.00000328
Further Details:      
 
Domain Number 2 Region: 54-174
Classification Level Classification E-value
Superfamily POZ domain 1.35e-31
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233259   Gene: FBgn0205988   Transcript: FBtr0234767
Sequence length 655
Comment type=protein; loc=scaffold_12970:complement(6451738..6451827,6452875..6453111,6453211..6453333,6453397..6453604,6453674..6454717,6455691..6455956); ID=FBpp0233259; name=Dvir\GJ18842-PA; parent=FBgn0205988,FBtr0234767; dbxref=FlyBase:FBpp0233259,FlyBase_Annotation_IDs:GJ18842-PA,GB_protein:EDW65545,REFSEQ:XP_002055344,FlyMine:FBpp0233259; MD5=1a3892f57b3916d66eeba36a21aefd78; length=655; release=r1.2; species=Dvir;
Sequence
MSSVNVNQKESPSRDSTASTSGHISMMAENTLESLSRDYSLVSLNSAGSQDEFFRCRDHA
DSVLKRMQLYVDSQQLCDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEHEV
TLGEVHGDALQLLVQYCYTGFIELREDTVETLLATACLLQLNSVVTACCNFLARQLHPSN
CLGFAFFAEQQSCTALLRLAQAYTCQYFMQVCQNQEFFQLNADQLGKLLCSDDLNVPSEQ
DVFHSLMSWVRHDAPNREQHIAELLALVRLPLLQPAFIMDNVESVCSANECQQLVMEAFK
WHLMPERRSRIATERTTPRKSTVGRLLAVGGMDAHKGAITIESYCPRLDKWTPWKHMTGR
RLQFGAAVMEDKLILVGGRDGLKTLNTVESLDLNTMAWVLLNPMATPRHGLGVAVLEGPL
YAVGGHDGWSYLNTVERWDPLARTWSYVAPMSSMRSTAGVAVLGGRLYAVGGRDGSVCHR
SIECYDPHTNKWSLLAPMNRRRGGVGVAVANGFLYALGGHDCPASNPMVCRTETVERYDP
VTDTWTLICSLALGRDAIGCALLGDRLIVVGGYDGNTALKSVEEYDPVRNGWNDLSPMSF
PRAGACVVAIPNVIPPAAPQPPASATKKKKWKPVRLDPICYRRRRSVEFVDYYHM
Download sequence
Identical sequences B4M1J1
7244.FBpp0233259 XP_002055344.1.90633 XP_015026447.1.90633 FBpp0233259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]