SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0233348 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0233348
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.28e-31
Family NodB-like polysaccharide deacetylase 0.026
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 3.92e-16
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0233348   Gene: FBgn0206077   Transcript: FBtr0234856
Sequence length 490
Comment type=protein; loc=scaffold_12970:complement(4264945..4265284,4269134..4269519,4271023..4271242,4286269..4286411,4293845..4293972,4301698..4301809,4301917..4302008,4310094..4310145); ID=FBpp0233348; name=Dvir\GJ18931-PA; parent=FBgn0206077,FBtr0234856; dbxref=FlyBase:FBpp0233348,FlyBase_Annotation_IDs:GJ18931-PA,GB_protein:EDW65387,REFSEQ:XP_002055186,FlyMine:FBpp0233348; MD5=e2798490c30aefea66f61d7b31dbdd48; length=490; release=r1.2; species=Dvir;
Sequence
MLQHCLFATLLIAVGVHAQTKEKDEFTCPSHIANGNYADPATCRRFYQCVDGYPYLNRCP
SGLYFDDVQKFCTFKDEAKCGPLPTTPAPATDAPADTAQRCNTDECQLPYCFCSKDGTQI
PGELEAEKIPQIIMLTFDGAVNLNNYDHYQKIFNGKRKNPNGCNIRGTFFLSHEYSNYQQ
IQHLGYAGHEIATESISQQLGLQDKGYEEWVGEMIGMREILRHFANVSANDVVGMRAPFL
KPGRNTQYKVLEDFGYIYDSSITVPPIPVPVWPYTLDFKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGFEGGHCPYMDQCVLHNLDENEVFEWLQEDFSRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALELPDVYILTVTQMLQYMTDPKELRDVSQIESWKCDKNIAVAPKP
CNIWQTCALPFKIPEQNLTDTRYMETCRECPNVYPWLGDAAGTGISGRDNYIFSSPNNEA
PEGDDAAKRK
Download sequence
Identical sequences B4M3L2
7244.FBpp0233348 FBpp0233348 XP_002055186.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]