SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0235853 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0235853
Domain Number 1 Region: 12-148
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-32
Family Cap-Gly domain 0.00096
Further Details:      
 
Domain Number 2 Region: 134-348
Classification Level Classification E-value
Superfamily L domain-like 2.18e-18
Family Internalin LRR domain 0.034
Further Details:      
 
Domain Number 3 Region: 438-522
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.4e-16
Family Ubiquitin-related 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0235853   Gene: FBgn0208562   Transcript: FBtr0237361
Sequence length 523
Comment type=protein; loc=scaffold_12875:join(4565326..4565421,4565482..4565954,4566013..4566436,4566493..4566775,4566836..4567131); ID=FBpp0235853; name=Dvir\GJ21436-PA; parent=FBgn0208562,FBtr0237361; dbxref=FlyBase:FBpp0235853,FlyBase_Annotation_IDs:GJ21436-PA,GB_protein:EDW60365,REFSEQ:XP_002049172,FlyMine:FBpp0235853; MD5=7d18af4318738a392f280100161bddab; length=523; release=r1.2; species=Dvir;
Sequence
MVGIIDEAQLFYPLGTRIKIANNYGTVKYVGEVSGHMGTWLGIEWDDGMRGKHNGMVDGK
RYFQTQMPTAGSFIRPGKLGPCATLEDEARERYLNYDSKNVDTSLIREAQASMQASLFEV
VGMDKIARKQSKFEQLTEMSVDETPVNAAGYLKDLTQLTTLNVSHTLIWNWEIVASITQQ
LPMLNSLNLGSNRLVLPTETQISELAPAFRHLKHINLGNCGFTDWQDVMQTALLWPDIES
LGLQENALSQLDVVDCNRIFRQLRELDLHRTKLMDFDQVCKLGNIRTLSVLNLMENGIEQ
LQLPDCEPQAKLNMFVSLEQLSLMQNPIWNETEAFNELDKLPQLKRLNKTPHLKSSFDEM
FSKAVASIAGIQFINKAKVSAEERRGAEYDIWKKYALDWLQATKLGADALRDFYKKHRTY
LLIVNKYGSPADFVPRIQAKQSNLIKVRIQHRLTGEVWEKKVPRMITVQTLQGLVMKRFH
IAGDTPHLCYIDAKHPELVVQLENNAKTLDFYSVQEHDTVLVE
Download sequence
Identical sequences B4LIJ5
XP_002049172.1.90633 FBpp0235853 7244.FBpp0235853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]