SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0238165 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0238165
Domain Number 1 Region: 290-620
Classification Level Classification E-value
Superfamily Subtilisin-like 4.97e-93
Family Subtilases 0.00000000037
Further Details:      
 
Domain Number 2 Region: 614-751
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.47e-38
Family Proprotein convertase P-domain 0.00015
Further Details:      
 
Domain Number 3 Region: 190-262
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.38e-21
Family Prohormone convertase 1 pro-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0238165   Gene: FBgn0210845   Transcript: FBtr0239673
Sequence length 1268
Comment type=protein; loc=scaffold_13047:join(2154617..2154784,2154857..2155351,2215439..2215684,2215738..2215866,2215932..2216806,2216866..2217039,2217437..2217555,2217721..2218965,2220192..2220358,2222652..2222840); ID=FBpp0238165; name=Dvir\GJ23748-PA; parent=FBgn0210845,FBtr0239673; dbxref=FlyBase:FBpp0238165,FlyBase_Annotation_IDs:GJ23748-PA,GB_protein:EDW66708,REFSEQ:XP_002053188,FlyMine:FBpp0238165; MD5=a88f14c7f720a06a2c9ee7e8da4f6f2c; length=1268; release=r1.2; species=Dvir;
Sequence
MKNDVVRWSRQPNSNINNNSSCSNSSSSSINCNVNNKHNQQGSIKNNALHKVRQHVQGQQ
QEQQTIVECDITNFNFNCNLLKNSFLTHNKTKRIRNRHPECSTATPTATRTWSLTATSPS
TAMLLILQFSIVVFLCNLNVGFAAKVEPGHAQSPLLPPYILDYEKGAASSSSSSGSPRSG
RAAGGDAGHYTHTWAVHIPNGDNNGIADAVAKEHGFVNLGKIFDDHYHFAHHKVSKRSLT
PATHHQTRLDLDERVHWAKQQRAKSRSKRDFIRMRPSRTSSRALSLVDVMTFDDPKWPQM
WYLNRGGDLDMNVIPAWQQGITGKGVVVTILDDGLESDHPDIEQNYDPKASYDVNSHDDD
PMPHYDMTDSNRHGTRCAGEVAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLS
LNPQHIDIYSASWGPDDDGKTVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREMD
NCNCDGYTNSIWTLSISSATEEGNVPWYSEKCSSTLATTYSSGGQSEKQVVTTDLHHSCT
VSHTGTSASAPLAAGIAALVLQSNQNLTWRDLQHIVVRTAKPANLKDSSWSRNGVGRRVS
HSFGYGLMDAAEMVRVARNWKTVPEQQRCEINAPHVDKVIPPRTHITLQLSVNHCLSVNY
LEHVQAKITLTSQRRGDIQLYLKSPANTKVTLLTSRMHDNSRSGFNQWPFMSVHTWGESP
HGNWQLEIHNEGRYMGHALLREWSLIFYGTTLTIDPNDPISVARASSGEQATTPNSSTTS
STTSNLHQIYSPQYPRISPNNFAQASAGGAKLPLGKMPPNKSNLVTNNPLLPLPPAPPAK
QGYQQISATYGVILGKTNNNNSNNNNNNKGNNKGNNKANKANKAGEKNGNGKTNKKEQAA
QNSSSSNIGNQGSNKNKYYRISQQHGGGGGGGGKSKGQANGLQTQRPKASSSEKYYEEKT
RKVIGEITTSNNNNNNNNNRGSNSSTAPRLPVKAAKQVKDSSPDSRIPKLFEHYDKIQAI
FPELEPYESSSLSKSKPGMQQQQQQQQKQQSPRKQGKQFEVELFRPTTGGAAGSNKPGNT
KKSPSAPPPPSQPILPAGGSSFLPDQRILKKQQLLMAAAGVLTPQNGDDDMSANDEEDDS
EEGILQLAPSTQITQWDMILYGTEVPAQPKDQIHENQQSQFNVFGNDMAHNDIEHDASGQ
WRNMQQVGEVGMTQDRSNAAACLKWSDQKCLGLSLIFLLITQVFYLNFKQAIAINKNNNN
GNSNKSIR
Download sequence
Identical sequences 7244.FBpp0238165 FBpp0238165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]