SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0238656 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0238656
Domain Number 1 Region: 5-163,390-639
Classification Level Classification E-value
Superfamily Serpins 1.88e-69
Family Serpins 0.0000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0238656   Gene: FBgn0211321   Transcript: FBtr0240164
Sequence length 657
Comment type=protein; loc=scaffold_13047:join(11303063..11304184,11304251..11305102); ID=FBpp0238656; name=Dvir\GJ24239-PA; parent=FBgn0211321,FBtr0240164; dbxref=FlyBase:FBpp0238656,FlyBase_Annotation_IDs:GJ24239-PA,GB_protein:EDW67598,REFSEQ:XP_002054078,FlyMine:FBpp0238656; MD5=943979eae7e33e2fdacf708dfed4aea0; length=657; release=r1.2; species=Dvir;
Sequence
MKAALCLLPLLACANIVCSLPPPPTKEDALPSMFASEASQLIATQLLKHNKDIDANQVHS
PLGVASILAVLAEAAEGETYAEFGQVFGFPKERQDLRAAFQRILGSYQNRDAAVALPSFQ
TWFYVYRNNSVREDYKQLLQRHYYVEVKDINRQEYDWSEPNTSLQLEGSGADVDSTEPSN
SKDVIGFETLKRINLDDDAPLVPSDTYGEEVLNKEASKFDREVDDKQYVEKPVALAEAAE
QLQRDQEREREQLTTELSATEAASSSTDAPVEKLEKPAEIALTVEENVAAKQQNKRSDAE
QNPNDEENETVQEDEKLRKLLNEPSNGGNQVTAGEPEKVRLPLQKLENAVKSMVKEGADE
IMIALESHLSTVARAYSARSLFRQDDIASALSANSITGRELGSKSKMLLFNGLYYRGSWA
QPFYQLRDGSDEFFFMTNEDAVKTPMMHARGKYNVTDLPHLKARLLSVPYENAQYSLCIV
LPNEPEGLSEVIAQLQPSDYKYAREHMQLKELHVTLPKFQVEETSRSEAMLQQLGLKRLF
SRTEAQLGLLTEDEDVHVDEIVQFVNVRVDEGGSSANSLSAATMQGRSPIAAEAAATLPV
PEPEPEPGVELFDVNRPFVYFVMDCKNQFVLASGKVYAPEFKDELPPVSIEVELEQS
Download sequence
Identical sequences B4LW64
7244.FBpp0238656 FBpp0238656 XP_002054078.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]