SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0215974 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0215974
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.28e-18
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0215974   Gene: FBgn0189122   Transcript: FBtr0217482
Sequence length 144
Comment type=protein; loc=chr3L_Mrandom_202:complement(405..464,526..900); ID=FBpp0215974; name=Dsim\GD17572-PA; parent=FBgn0189122,FBtr0217482; dbxref=FlyBase:FBpp0215974,FlyBase_Annotation_IDs:GD17572-PA,GB_protein:EDX15730,REFSEQ:XP_002076543,FlyMine:FBpp0215974; MD5=8e2038047ffe9e00827c4efee0e9a1f7; length=144; release=r1.3; species=Dsim;
Sequence
MRALSAEMVKLAAQDLRIERLDVQQDLAQEMFKDSKYKSEQLPSIAQQTNGRVTLYRLGD
HIDISRGPMVASTSFLGKCVISAAHKVAEEGPSGAFYRIQGVALPSGFQLNHVAFGVLEE
RSKKPSPARLPNEPFEEQQQLQLS
Download sequence
Identical sequences B4NT40
FBpp0215974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]