SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0209884 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0209884
Domain Number 1 Region: 414-742
Classification Level Classification E-value
Superfamily L domain-like 2.04e-49
Family Internalin LRR domain 0.088
Further Details:      
 
Domain Number 2 Region: 108-454
Classification Level Classification E-value
Superfamily L domain-like 1.01e-46
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 3 Region: 814-998
Classification Level Classification E-value
Superfamily L domain-like 1.17e-27
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 4 Region: 1094-1234
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.35e-22
Family Toll/Interleukin receptor TIR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0209884   Gene: FBgn0084945   Transcript: FBtr0211392
Sequence length 1444
Comment type=protein; loc=2R:14373428..14377762; ID=FBpp0209884; name=Dsim\GD11482-PA; parent=FBgn0084945,FBtr0211392; dbxref=FlyBase:FBpp0209884,FlyBase_Annotation_IDs:GD11482-PA,GB_protein:EDX07855,REFSEQ:XP_002082270,FlyMine:FBpp0209884; MD5=d1e959fbde07eb52aefd163b238dc13c; length=1444; release=r1.3; species=Dsim;
Sequence
MAAILLLLLGFSWSLAVESALAPKESESSASAMLGAGTGAAATVSLSGDYSSLLSNVPAA
SPVPANPSQHSGPANQCSWSYNGTSSVHCALRLIERQPGLDLQGADGSSQLTIQCSELYL
FESTLPVAVFARLQTLEALRLESCKLLQFPNNAFEGLATLKSLRLSTHNSEWGPTRTLEL
FPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRIRTAEQLGFADMNCGA
GSGSAGSELQILDASHNELRSISESWGISRLRRLQHLNLAYNNISELSGEALAGLASLRI
VNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNH
VDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNL
HTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNE
VPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLS
VLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD
YAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFI
NNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKPLPEFYLGGNPFEC
DCTMDWLQRINNLTTRQHPRVMDMANIECVMPHARGAAVRPLSGLRPQDFLCRYESHCFA
LCHCCDFDACDCEMTCPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYLDGNN
FPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQL
SALRELYLQNNQLTTIENATLAPLAALELIRIDGNRLVTLPIWQMHATHFGTRLKSISLG
RNQWSCRCQFLQALTSYVADNALIVQDAQDIYCMAASSGTGSAALEDSSSNSGSLEKREL
DFNATGAACTDYYSGGSMLQHGIPESYIPLLAAALALLFLLVVIAMVFAFRESLRIWLFA
HYGVRVFGPRCEESEKLYDAVLLHSAKDSEFVCQHLAAQLETGRPPLRVCLQHRDLAHDA
THYQLLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALRGRPQKLVIIEEPEVAFEA
ESDIELLPYLKTSAVHRIRRSDRHFWEKLRYALPVDYPTFRGNNYTLELDHHNHERVKQP
ASPGLLYRQAPPPAYCGPADAVGIGAVPQVVPVNASVPAEQNYSTATTATPSPRPQRRGE
QPGSGSGGNHHLHAQYYQHHGMRPPSEHIYSSIDSDYSTLDNEQHMLMMPGAPGGLAMEA
AQRAQTWRPKREQLHLQQAQAGTLGSKASQAAHQQQQQQQQQQQPNPTAVSGQQQGPHVQ
AYLV
Download sequence
Identical sequences B4QEI1
XP_002082270.1.80810 FBpp0209884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]