SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0210665 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0210665
Domain Number 1 Region: 324-394
Classification Level Classification E-value
Superfamily WWE domain 9.16e-21
Family WWE domain 0.00011
Further Details:      
 
Domain Number 2 Region: 122-173
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000177
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 168-223
Classification Level Classification E-value
Superfamily WWE domain 0.00000000327
Family WWE domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0210665   Gene: FBgn0183998   Transcript: FBtr0212173
Sequence length 501
Comment type=protein; loc=3L:complement(18957376..18957470,18958797..18959234,18959544..18959900,18959981..18960134,18960856..18960986,18961337..18961667); ID=FBpp0210665; name=Dsim\GD12263-PA; parent=FBgn0183998,FBtr0212173; dbxref=FlyBase:FBpp0210665,FlyBase_Annotation_IDs:GD12263-PA,GB_protein:EDX11105,REFSEQ:XP_002085520,FlyMine:FBpp0210665; MD5=bbabef64624c32a45fa256a370750392; length=501; release=r1.3; species=Dsim;
Sequence
MSQQRSTEQISASNNSTTSDAIALDDDEDMDVQFVAALRPDAPVIDLCLSPSTSAAAATA
AAAATAAHSGGGSGEDPAVGSASGAAAAASDTDSLASSPDEAALATGVDAAAAVSGEDSP
SAAAAALECPICLQTCIHPARLPCGHIFCFLCVKGVAYKNRRCAMCRREIPAEFLDHPQL
VNGIEDICTTRATEDGFQWYYEGRNGGWWAYDSRTNADIEIGYAGFEIFKADNPHIAALF
DRDCPNPINNYCLSDDSVMFYNADSEIVIHPTHIRSSGQGGPADSENNGRNSPVLTLEDI
IDLDPDDLNIIRPHPCVLHIQICGRWWQYDDRTSQDIEDAFKKGDKSCTILVAGYVYIVD
LEQLVQQRQNEPTRCRRVKRDLATIPKKGVAGLRIEGNQVTSDTVFSRPTNTANPTTVAA
AASSFISTIAATDAAIRIASDIIGSTLAHADELTRGLTASNLSNDDLSSSDSFPICTPPL
LLTAKCVFVASLISTIYLKLY
Download sequence
Identical sequences B4QQW7
FBpp0210665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]