SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0210991 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0210991
Domain Number 1 Region: 722-755
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000873
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 2 Region: 804-849
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000123
Family Ovomucoid domain III-like 0.0061
Further Details:      
 
Weak hits

Sequence:  FBpp0210991
Domain Number - Region: 858-890
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00011
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number - Region: 670-736
Classification Level Classification E-value
Superfamily FnI-like domain 0.0022
Family VWC domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0210991   Gene: FBgn0184316   Transcript: FBtr0212499
Sequence length 1071
Comment type=protein; loc=3L:complement(14312240..14313042,14313103..14314668,14314731..14314872,14315024..14315229,14315304..14315418,14318887..14318942,14322565..14322892); ID=FBpp0210991; name=Dsim\GD12589-PA; parent=FBgn0184316,FBtr0212499; dbxref=FlyBase:FBpp0210991,FlyBase_Annotation_IDs:GD12589-PA,GB_protein:EDX10494,REFSEQ:XP_002084909,FlyMine:FBpp0210991; MD5=6260e179c770767167eea648ea62257c; length=1071; release=r1.3; species=Dsim;
Sequence
MRLSGWEILLLLLPFGVVSAVRQLEENQSIKNDHHHSVERQVRRRNNKSNASVDHHRHAP
SSGSKKNSRSHSVSLDSDDYDWLDADTSEAIDSSEVTAVESVRSPGESHDIFTCCNQVFG
SCRTACENLSLVEFATGTGGDNRDELHRYCQLHQVEFWTCVNQTFDAVTRGAYWSGRRCC
QFGVLPHCRNVCATSTRSPVQNCRRSDEQTLYDCLERQEAADQCCGQARTSECLEACRAV
FEPANDNHDHVDINGACGDRNADVIQCVNNHTDMTPLANAEQYIPCCEYSSKEHCRHTCR
NLLHQNATLMERSEVIFARLEAAGCGSPLPQLPFWQCFLTVTGKLYVPGGSGRAGGSLAQ
GRISGQGGALAEPNHLGMDAAKRQCCEQASSHKCRRLCNQIFTSNWWDARSSFENECMDQ
PGERELRRCIESVDAPCELGCQGLSFCSNFNNRPTELFRSCTPEHDAAAREDWQLLQQRG
TVRVLGQELFIKNTSRCAPDKWRALVCALQIKPCTRVGLFNGICSEDCHDLLDECLDWTL
QHQRPKDICSRLKEKDDDDSPLPCISLESYLKPGDASPEEFQGITSPCAKKPCNGSEVCI
LQRGGNQGYSCIPGCNLGQDSKLFVPFGSYVRLGKSNLHKKLEVGQFPLAEHIVCSCGLQ
GRLEQCQPLPSYMHAHCTLPGARSYRHGSSFYLECNLCSCFAGEITCTKQQCRLPGFADS
SYTSLPCNCPAHYVPVCGSNGNTYPSACVAKCHLPEGDYVYGACNARNACQAAPPNSCPS
GTQCLDSRKVCLASMQRPCLQYVCVNFTASNCSTFHQGEVCDAHGRTYPNACALLKANPQ
GQVAYWSACQSSRFNTSPSPVCGINGVTYKSSYAARAEYVLVDYVGRCREVGLLVSDMGR
RCRTVKCPAPASKHCRLIVPPGACCPLCAGGAFRIIYSRKQFDRAMYGLRAQSSTLLTLH
GVLHQLDGLVQVSECQLTGFLTMEVGIFVAIVPASSIKRPTRLQLEACAREAEKISSLIN
AQSPRITTNLALSCLTVSHLLEPTPNGATSYGPHAIWILPLLLLVSRLIIA
Download sequence
Identical sequences B4QKI3
XP_016031909.1.80810 XP_016031910.1.80810 FBpp0210991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]