SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0216576 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0216576
Domain Number 1 Region: 412-671
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-50
Family YWTD domain 0.00000105
Further Details:      
 
Domain Number 2 Region: 311-403,672-719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 28-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000851
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 4 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 5 Region: 231-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 66-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 150-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 285-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 192-231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0216576   Gene: FBgn0189710   Transcript: FBtr0218084
Sequence length 883
Comment type=protein; loc=3R:complement(21394459..21394491,21394668..21394829,21394907..21395040,21397388..21397546,21397707..21397905,21398004..21399416,21399997..21400223,21401109..21401231,21402248..21402367,21404971..21405052); ID=FBpp0216576; name=Dsim\GD18174-PA; parent=FBgn0189710,FBtr0218084; dbxref=FlyBase:FBpp0216576,FlyBase_Annotation_IDs:GD18174-PA,GB_protein:EDX14465,REFSEQ:XP_002104962,FlyMine:FBpp0216576; MD5=4aa08823166eae2b32e122dcd3b1e0e4; length=883; release=r1.3; species=Dsim;
Sequence
MGRIWCLLFVSSLLHTQSQSFRVLAINEATCSSDQFRCGNGNCIPNKWRCDQESDCADGS
DEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADEFTCG
NGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDG
SDERSCANVTKTTTPCLSHEYQCKDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRA
DQFQCGDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGVNQGGCNSTSEFDCGGGQCVP
LSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKR
NCQDINECEVPGKCSQICVNEMGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDI
RKIALDHMEMTSIVNSTKAATALDFVFRTGMIFWSDVTTQSIYKAPIDEGNEKTVVLTKS
SVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMY
WSDWGASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDG
SQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPM
VVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMVDGLMCVE
DLTRPPRARKTKPRTKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRP
VKNHTQIEKTTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIGYRYCSKRRINSMNFEN
PIYRKTTTTEDHFSLRKNLPARIYDHTSVMDEEYSPVIGISSY
Download sequence
Identical sequences B4QVD9
FBpp0216576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]