SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0217476 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0217476
Domain Number 1 Region: 180-497
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-98
Family Protein kinases, catalytic subunit 0.00000000048
Further Details:      
 
Domain Number 2 Region: 23-132
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-23
Family Pleckstrin-homology domain (PH domain) 0.000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0217476   Gene: FBgn0190581   Transcript: FBtr0218984
Sequence length 530
Comment type=protein; loc=3R:complement(9547895..9547978,9548051..9548197,9548266..9548499,9548563..9548952,9549018..9549215,9549292..9549831); ID=FBpp0217476; name=Dsim\GD19074-PA; parent=FBgn0190581,FBtr0218984; dbxref=FlyBase:FBpp0217476,FlyBase_Annotation_IDs:GD19074-PA,GB_protein:EDX12729,REFSEQ:XP_002103226,FlyMine:FBpp0217476; MD5=b54fbb0b389614a0c572b02ecea13374; length=530; release=r1.3; species=Dsim;
Sequence
MSINTTYDLSSPSVTSGHALTEQNQVVKEGWLMKRGEHIKNWRQRYFVLHSDGRLMGYRS
KPADSASTPSDFLLNNFTVRGCQIMTVDRPKPFTFIIRGLQWTTVIERTFAVESELERQQ
WTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKV
TLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKST
NHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLH
SQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDY
GQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAK
DPKKRLGGGKDDVKEIQAHPFFASINWTDLVQKKIPPPFKPQVTSDTDTRYFDKEFTGES
VELTPPDPTGPLGSIAEEPLFPQFSYQGDMASTLGTSSHISTSTSLASMQ
Download sequence
Identical sequences B4HLD8 B4QXQ5
FBpp0217476 XP_002030972.1.34323 XP_016034453.1.80810 XP_016034454.1.80810 XP_016034455.1.80810 FBpp0205761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]