SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0218583 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0218583
Domain Number 1 Region: 546-806
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-79
Family Protein kinases, catalytic subunit 0.0000207
Further Details:      
 
Domain Number 2 Region: 404-520
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-23
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 204-274
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.09e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Domain Number 4 Region: 80-155
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0218583   Gene: FBgn0191659   Transcript: FBtr0220091
Sequence length 836
Comment type=protein; loc=3R:join(7347400..7347525,7348908..7349052,7349488..7349625,7349711..7349895,7350622..7351603,7351661..7352398,7352468..7352664); ID=FBpp0218583; name=Dsim\GD20181-PA; parent=FBgn0191659,FBtr0220091; dbxref=FlyBase:FBpp0218583,FlyBase_Annotation_IDs:GD20181-PA,GB_protein:EDX12460,REFSEQ:XP_002102957,FlyMine:FBpp0218583; MD5=c833b956d6c02ac5606481df7d6cdc0b; length=836; release=r1.3; species=Dsim;
Sequence
MEGPEVTFLFQFGSVRDAVCVPASSLTLKTLKDLACDFINTKIPDSGLTYLSERILLFVH
DYSTPNVLHIINSAAEVVDETLVEIVLTASPILYPTSEMPTLKPHSLNVHSYKGPTFCDF
CGEMLFGLVRQGLKCDGCGQNYHKRCVVKIPNNCNRSNDATSRRSFTLQAPRSPSGSSQQ
SLVSTEDSTGRNDSSSSLNIPGRHQRTHSSGSRNGLMVLRIPHTFMVHTYGIPTVCQLCK
KLLKGLFKQGLQCRDCQYNTHKKCMDKVPHDCTGEAQLSQLQIQAGAKERDNFFREEFDD
SDGDDGSEYGKYKSAMSSGVNLVAGRPREAPKALTNAHNSPPELVNGGLVDDSSVSGGET
SKSSSDGQSEQSQSSTSSSPSANIPLMRIVQSVKHTKKRGGQALKEGWLVHYTSLDKAVK
RYYWRLDSKTITLFVSEQGSKYHKELPLAELLSIESHLGDPRPECNYCFELRLPNLSYFV
GQDPQVGAKEEQAVRLPPPDSGIGSDIAKSWETSIRQAFMHVTNTQCCESEEQVQDMGQL
YQIFPDEVLGSGQFGVVYGGVHKKTQREVAIKVIDKLRFPTKQEAQLKNEVAILQNISHC
GVVNLERMFETPERIFVVMEKLKGDMLEMILSHARGRLSERVTKFLITQILIALKYLHSQ
NIVHCDLKPENVLLSSDAEFPQVKLCDFGYARIIGEKSFRRSVVGTPAYLAPEVLRNKGY
NRSLDMWSVGVIIYVSLSGTFPFNEEEDINDQIQNAAFMYPPNPWKEISSNAIDLINNLL
QVKQRKRYTVDKSLLHYWLQDKQTYRDLRNLEAQVGAGRYLTHEADDLRWDCAGDM
Download sequence
Identical sequences B4QUG0
FBpp0218583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]