SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0218885 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0218885
Domain Number 1 Region: 8-34,74-139
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.63e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 159-258
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-22
Family Voltage-gated potassium channels 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0218885   Gene: FBgn0191954   Transcript: FBtr0220393
Sequence length 408
Comment type=protein; loc=3R:join(11937742..11937868,11938300..11938455,11938510..11938636,11938694..11938884,11938941..11939128,11940067..11940227,11940640..11940672,11940855..11941098); ID=FBpp0218885; name=Dsim\GD20483-PA; parent=FBgn0191954,FBtr0220393; dbxref=FlyBase:FBpp0218885,FlyBase_Annotation_IDs:GD20483-PA,GB_protein:EDX13045,REFSEQ:XP_002103542,FlyMine:FBpp0218885; MD5=01a0f2c2744c4d2b68f268d4d4c9b110; length=408; release=r1.3; species=Dsim;
Sequence
MKKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFK
VMETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPL
GLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSK
FEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLN
LLVLRFVTMNTEDERRDEAQAMQALQVAVKLEGDVITSNGSILSGYEGHDGQSLNGSNTS
SMCSCHCICLNGNRHKKSSNLGKNNDAENQYKLRRSPTHIRHLLPEVVPMQDLNYDYDTQ
SLHTLADRGTMDSSYMGVDMADMGDTASMELRPHTLLKRNVSLLSIRI
Download sequence
Identical sequences B4R168
XP_016034825.1.80810 FBpp0218885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]