SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0219199 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0219199
Domain Number 1 Region: 144-259
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-23
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 8-35,75-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-20
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0219199   Gene: FBgn0192260   Transcript: FBtr0220707
Sequence length 340
Comment type=protein; loc=3R:join(16090475..16090604,16090668..16090823,16090890..16090951,16091008..16091408,16091464..16091737); ID=FBpp0219199; name=Dsim\GD20797-PA; parent=FBgn0192260,FBtr0220707; dbxref=FlyBase:FBpp0219199,FlyBase_Annotation_IDs:GD20797-PA,GB_protein:EDX13630,REFSEQ:XP_002104127,FlyMine:FBpp0219199; MD5=5d1321466cfd6b8d7c807f59ad711318; length=340; release=r1.3; species=Dsim;
Sequence
MMKRQNVRTLSLVVCTFTYLLIGAAVFDSLESPTEAKRWDFLQTVKNNFVRKYNVTDEDF
RVMEIVIIENKPHKAGPQWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAFCMGYAMVGIP
LGLVMFQSIGERLNKFASVIIRRAKRASGARCTDATEMNLMLATGMLSSIIITTGAAVFS
RYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSLVFILFGLAVVAASI
NLLVLRFMTMQAEDAKRDEQDAQNLAGNAQPVTFDDESTYNTHGKLLENNYTTENDETAS
LCSCTCMGGTRCLNHEQFVDPDFQPTDIIESTLCLKRASV
Download sequence
Identical sequences B4QWM6
FBpp0219199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]