SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0221987 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0221987
Domain Number 1 Region: 967-1113
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.23e-35
Family Toll/Interleukin receptor TIR domain 0.0005
Further Details:      
 
Domain Number 2 Region: 598-721,763-888
Classification Level Classification E-value
Superfamily L domain-like 1.05e-19
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 3 Region: 388-504
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000258
Family Ngr ectodomain-like 0.063
Further Details:      
 
Weak hits

Sequence:  FBpp0221987
Domain Number - Region: 251-401
Classification Level Classification E-value
Superfamily L domain-like 0.0493
Family Internalin LRR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0221987   Gene: FBgn0194963   Transcript: FBtr0223495
Sequence length 1125
Comment type=protein; loc=2L:join(8864348..8864471,8865656..8865763,8866627..8867308,8867362..8869825); ID=FBpp0221987; name=Dsim\GD23585-PA; parent=FBgn0194963,FBtr0223495; dbxref=FlyBase:FBpp0221987,FlyBase_Annotation_IDs:GD23585-PA,GB_protein:EDX04327,REFSEQ:XP_002078742,FlyMine:FBpp0221987; MD5=5868e866ce6ba0efec0b022dbe9b2c0c; length=1125; release=r1.3; species=Dsim;
Sequence
MEHSKLWDLRPEVRERRFKWTSDGQQQQQQQLGWCNNKDDPPNSHQKSKSNNDARNLNSR
VRVRARVRVVPGEMRMGDINCSKGLGNIREDYCEIYLGEFGEDRTCSIANNIVTTEDYQM
KLVFLKLQINWTSPVFHRWNILKISNETNNELVTISVLGIRSEVDMRISPAVQYLSLLGI
QEISGYDIYLPSVLITEMDVHHVNGPKMVTFKYLYDSPDNSVITNNYIRKTMNSTEKIKI
YYLNTFEKTTLTMEENIFHGKDKLSAVIFTGLKIEGLTDKTFENVTSLSTLIFDYVVLKD
LSFLRSPTLQASLKYCIMKVENTVDLKSFAKFTNLEIIEVNRYKAFKSLTAFICETYKSH
CKFTLGINGVACPLKCNCSYNRDKSQLEIDCWQKNLTTIPLLPIPKKGNSALVFQSNLLT
ELPYNSLEGYRNIKSLDVSYNQLTSLSISQLPESLHYLDIRHNKITTLSPEVVEYLYSVN
IFNQFGNKWIIYCDEYHLQEFFWYKAKLLRIKTSKFETIMEYIELSAKGSFVENFFVENI
DLLYKEANEDEIIDAFGHSDKYFNLKLMEALNHAIWLFSGEFDEIILHHLNAPCPYRCSC
CFERLTDEFLINCQNLSLDSYPRLPNSIPYNTTLYLDANEITKLTNTESVIVSGHASIQK
LHMAQNLLRELPLHLLPENITYLDVRNNLLKYMDDGVIAFLEYRENITKIELSGNPWECN
CKAKAFLIFSQEHEPMEYDAVLRRVEITQDMCPEDCICCVDTSNPDSLALMVDCSGKELS
EIPPLPTPTYGQTTLVFERNSLKKWPSSLLPGYSSLTRFYLANNRLSDIDQLPDNLEYLD
ISNNNFSALDDRVRGFLQKRMNSSQLQLSLFGNPWTCRCEEKDFLVFVKEQAKNIANASA
IQCSDTGRSLIEVEETDICPSVLIYYTSLAVSLLIIALSINFFICFRQPIMIWFYEHEIC
LSLAARRELDEDKKYDAFLSFTHKDEDLIEEFVDRLENGRHKFRLCFYLRDWLVGESIPD
CINQSVKGSRRIIILMTKNFLKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVENFDDLD
SELRAYMVLNTYLERNNPNFWNKLMYSMPHARHLKRSLSDAETKV
Download sequence
Identical sequences B4Q7P5
FBpp0221987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]