SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0223731 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0223731
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.33e-39
Family BAR domain 0.0033
Further Details:      
 
Domain Number 2 Region: 234-314
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000707
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0223731   Gene: FBgn0196627   Transcript: FBtr0225239
Sequence length 320
Comment type=protein; loc=2R:complement(13906358..13906486,13906544..13906784,13907363..13907553,13907633..13907668,13908350..13908637,13908798..13908875); ID=FBpp0223731; name=Dsim\GD25329-PA; parent=FBgn0196627,FBtr0225239; dbxref=FlyBase:FBpp0223731,FlyBase_Annotation_IDs:GD25329-PA,GB_protein:EDX07798,REFSEQ:XP_002082213,FlyMine:FBpp0223731; MD5=7f75235d3a0fd73eaf2334a6bf28c3be; length=320; release=r1.3; species=Dsim;
Sequence
MNINLPNFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEK
IVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQAL
IKKDGISLEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVR
YYKQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPGNNHSANMAAT
GHKPNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLL
KGLVPRAFVEMLDEEHDVTL
Download sequence
Identical sequences B4QDP2
FBpp0223731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]