SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|350269397|ref|YP_004880705.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350269397|ref|YP_004880705.1|
Domain Number 1 Region: 50-173
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.57e-40
Family Insert subdomain of RNA polymerase alpha subunit 0.0000394
Further Details:      
 
Domain Number 2 Region: 7-50,174-228
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.22e-28
Family RNA polymerase alpha subunit dimerisation domain 0.0011
Further Details:      
 
Domain Number 3 Region: 249-313
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.03e-23
Family C-terminal domain of RNA polymerase alpha subunit 0.000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|350269397|ref|YP_004880705.1|
Sequence length 318
Comment DNA-directed RNA polymerase alpha subunit [Oscillibacter valericigenes Sjm18-20]
Sequence
MIEIEKPQIECIEAPGDITYGKYVVEPLERGYGTTLGNALRRIMLSSLPGTAATSIKITG
VQHEFSTIPGVKEDVTEIVLNIKGLLTKLHGESGKTVYIEAVGPCEVTAGDIKADGEVEI
LNPELHIATLDSGSTLNMEITLSHGRGYVSADKNKQAMSQQVIGVIPIDSIYTPVYKVNY
SVEPTRVGTSSDFDKLTLEVWTDGTISARDAVSLGAKILCDHFTLFTDLSENVGSKPTVV
EKGETQRDKVLEMTIEELDLSVRSFNCLKRANINTVEDLISKTEDEMMKVRNLGRKSLEE
VVNKLSMMGLSLADEENN
Download sequence
Identical sequences G4KVX7
WP_014116886.1.66763 gi|350269397|ref|YP_004880705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]