SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|350272209|ref|YP_004883517.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350272209|ref|YP_004883517.1|
Domain Number 1 Region: 78-212
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.11e-27
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 5-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.23e-21
Family GntR-like transcriptional regulators 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|350272209|ref|YP_004883517.1|
Sequence length 221
Comment putative GntR family transcriptional regulator [Oscillibacter valericigenes Sjm18-20]
Sequence
MLEKQLPYKHRVYEILKKEILSGHYKPGDVLNERKLSENLGISRTPVREALQMLEQDGWL
QIETYKGAVVREFDWRYMQETARIRSALEVCAIEDAAAHITESDLALLEQIQEEQQKVLE
NFDLEAFIMQDRRFHTCLYKLSGNHQLIRLLENYYDIFRFLGTQAVMNSVERRLTTLLEH
QAILDALKRRDIAGAVQAMKDHMRHTEENMQNHRARALAVE
Download sequence
Identical sequences G4KXK3
WP_014119609.1.66763 gi|350272209|ref|YP_004883517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]