SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0159631 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0159631
Domain Number 1 Region: 53-118
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000157
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0159631   Gene: FBgn0133178   Transcript: FBtr0161139
Sequence length 138
Comment type=protein; loc=scaffold_6540:26857789..26858205; ID=FBpp0159631; name=DmojGI10414-PA; parent=FBgn0133178,FBtr0161139; dbxref=FlyBase:FBpp0159631,FlyBase_Annotation_IDs:GI10414-PA,GB_protein:EDW16238,REFSEQ:XP_002000777,FlyMine:FBpp0159631; MD5=dfe0f0cc03f7a75af0787d17a7e002dc; length=138; release=r1.3; species=Dmoj;
Sequence
MKQLELSLLCLCLCLLIGPLWAADTPTWQLPTAQATQRIQRSCQKSSAGQRANQLRCLVE
QLGLWTDEQGYNARRIAKIFAAHQQTEELMLVVEYCNDRERRLQQKPAQWAYAAYKCATA
GTLGQWLREYKRQMQAIK
Download sequence
Identical sequences B4K601
FBpp0159631 XP_002000777.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]