SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0159755 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0159755
Domain Number 1 Region: 341-599
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.49e-86
Family STAT DNA-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 600-722
Classification Level Classification E-value
Superfamily SH2 domain 5.9e-20
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 3 Region: 195-346
Classification Level Classification E-value
Superfamily STAT 0.00000000000000412
Family STAT 0.0073
Further Details:      
 
Weak hits

Sequence:  FBpp0159755
Domain Number - Region: 1-91
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 0.000157
Family Transcription factor STAT-4 N-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0159755   Gene: FBgn0133302   Transcript: FBtr0161263
Sequence length 775
Comment type=protein; loc=scaffold_6540:join(28582982..28583106,28583432..28584474,28584542..28585027,28585096..28585365,28585437..28585637,28585875..28586013,28588023..28588086); ID=FBpp0159755; name=DmojGI10538-PA; parent=FBgn0133302,FBtr0161263; dbxref=FlyBase:FBpp0159755,FlyBase_Annotation_IDs:GI10538-PA,GB_protein:EDW16438,REFSEQ:XP_002000977,FlyMine:FBpp0159755; MD5=8a0fc1bb36f5e49f83bc2112c0ed9880; length=775; release=r1.3; species=Dmoj;
Sequence
MSLWKRISSHADCEQRMAAYYNKKGLYDLRLCLAPWIEDRIMSEQITPNSTNQLEHVAVK
FIEDLQQKLLSTRASDQVLKYRLVELCALIQRTPALELYTHLRSGVQKELQLAAEKSVAV
ASAGQSMPLNTYNMNNAAVAAAVGMNTGYVDASDLLGVAGTGVSPVAGGMPAGIMHNMAE
TAAPGRVGPAKMELYEVHNQIFQSFNEFTTCSESLKVLVQNYRYMLNAPNSPDAERLFKS
LIEDKAALVARLRRSFMFYDQLQDMVITELKNWRRQQALAGNGAQFSENMLDDIQRCFEL
LESFVTHLLTAVKETLLVRIVNDDPDLNCLLEQVQVAQKNLVCSAFIVDKQPPQVMKTNT
RFAASVRWLLGSQLGIHMNPPTVECIIMSELQAQRFVTRGTHMDVTNGSLAGQSSGEIQN
CSSTMEYQQSSHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYATTTVNDYQIRVW
TLSLPVVVIVHGNQEPQSWATITWDNAFADIVRDPFVVTDRVTWRQLSVALNTKFGSCTQ
RALTAENLEFLFEKLQRDNIAGERNEYISWNQFCKEPLPDRTFTFWEWFFAIMKLTKDHL
LSMWKAGRITGFINKAKAHDDLLRAVTGIGTFLLRFSDSELGGVTIAYVNACGSVTMLSP
WTARDFQILNLADRIRDLDMLRCLHPTDVNVQPLDRDLAFGDFYTQRAEPTPRVDGYVPS
TIRVQVRTSGDTGSISGTPHHPMQSPPQDSMSMGNGSDFPMTDFDTMQNFDVYKL
Download sequence
Identical sequences FBpp0159755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]