SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0160511 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0160511
Domain Number 1 Region: 223-343
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-23
Family SH2 domain 0.00073
Further Details:      
 
Domain Number 2 Region: 634-803
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-23
Family Ras GEF 0.021
Further Details:      
 
Domain Number 3 Region: 45-102
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000687
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0160511   Gene: FBgn0134055   Transcript: FBtr0162019
Sequence length 949
Comment type=protein; loc=scaffold_6500:complement(13670340..13670466,13670530..13670936,13670996..13671430,13672191..13673207,13673453..13673807,13675283..13675451,13675511..13675666,13675741..13675866,13675984..13676041); ID=FBpp0160511; name=DmojGI11294-PA; parent=FBgn0134055,FBtr0162019; dbxref=FlyBase:FBpp0160511,FlyBase_Annotation_IDs:GI11294-PA,GB_protein:EDW12164,REFSEQ:XP_002002722,FlyMine:FBpp0160511; MD5=971cd28727912369396871c97b0c4d92; length=949; release=r1.3; species=Dmoj;
Sequence
MGNVQTRQLDSRNATNRRSSILWNFRYPNGSRRRDDVAMIIHNSRLSISEWLNLLELQQY
EENLNMYATVNDVGDLTDRDLKRLGVRSITHRQKMLNSLLGVRAKRRQSMNLEAMRSAPC
AVPRRKGSCPMVYLDPDNVADSNDSGGAPVVTTKSGKVLKQLTFDETTTIYEELKPRSKC
NSPHWGDNADDMESGNNSNVSTPLAASPNPNEQQEAIALKKALEWELSLDARELRSHAWY
HGALPRQRAEEIVQREGDFLVRDCASQPDNYVLTCRSKAAVLHFVLNKLVLQPETVYERV
QYQFEEDAFDTVPDLITFYVGSGKPISAASGALIQYPCNRTYPLSFYGHKIVGNQLHSQM
LAGLRGLSPLNSPMGNNNAGGSAIFRFGQLTGDVAATQQQQPQQQQQAGTPASPHCSPPR
VRRDVPPPRLPCKKQQRSQSLTPAQAMVVCNINKQQEQQQQLGATDATNGHGLARFQTIA
RCNPTSDMQLQSQHLEHKFSTQSLPRPSTSAAQALRQQAAARICSLARNCSLDTPDRPPS
PPPKPRKEPMAAVLAYQASGSDSGNGSGDSAPGDISELSIQRGGVIIKNPRFMSSSISNG
TLKSFTEFDAIAAEEQLFTLPIEEFKLCSKFDFENFSTLLLPSVENKPLDGDALNTFKMM
LLETGPKLLAEHITRIDVGLFLDKPANDSDCYLSCSGLELLTLPHGKVFREDIIERTQCI
KLMVAVTILTCQTDLDRAELLSKWIQVAVETKTALGNLFGFCAIMLGLCMQQIQKLDQAW
HILRQKYTDSAFTFEAKLRPTLSSMNEASNPQAPNTTVPHVLLYALLIDRPILDIIDHSN
VDERPALYNTCIAPWESKADDFGMTINFQHLDASRGFLKNLDLYRKNAKIIMEEASTRLD
ELLADAFRTEFHVKFLWGSSGATAKPEDRHGKLEKVLTLMADKFCSVSA
Download sequence
Identical sequences B4KGG8
XP_002002722.1.58863 FBpp0160511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]