SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0162222 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162222
Domain Number 1 Region: 27-134
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.01e-31
Family Insect pheromone/odorant-binding proteins 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162222   Gene: FBgn0135762   Transcript: FBtr0163730
Sequence length 147
Comment type=protein; loc=scaffold_6680:join(5994080..5994151,5994214..5994292,5994353..5994441,5994498..5994600,5994670..5994770); ID=FBpp0162222; name=DmojGI13005-PA; parent=FBgn0135762,FBtr0163730; dbxref=FlyBase:FBpp0162222,FlyBase_Annotation_IDs:GI13005-PA,GB_protein:EDW18016,REFSEQ:XP_002007540,FlyMine:FBpp0162222; MD5=66ed849e31297fc887f4ff15fce2d5f5; length=147; release=r1.3; species=Dmoj;
Sequence
MYSKTLSVTLALLVLCCEITPHQAFDVPEVVKKHVKKLHKRCVAKTGVSEELLEHAQKGN
LPNDPTFKCFLHCMFDMFGLIDSDNVMHLEALVEVLPVEIHDKILALVDACGKKKGVDGC
DTAYQSVECYMATDAPFMLSGITEILG
Download sequence
Identical sequences B4L070
XP_002007540.1.58863 FBpp0162222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]